KEGG   Citrobacter koseri: CKO_04851Help
Entry
CKO_04851         CDS       T00592                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cko  Citrobacter koseri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CKO_04851
Enzymes [BR:cko01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CKO_04851
Exosome [BR:cko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CKO_04851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4456845..4459031)
Genome map
AA seq 728 aa AA seqDB search
MSDRIDRDVINALIAGHFADPFSVLGMHQTTAGLEVRALLPDATEVWVIEPKTGRKVGKL
ECIDSRGFFSGVLPRRKNFFRYQLAVVWHGQQNLIDDPYRFGPLIQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNAQRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GAQHGQLYKFEMIDAHGKLRIKADPYAFEAQMRPETASLICGLPEKVVQTEERKQANRFD
APVSIYEVHLGSWRRHTDNNFWLSYRELADQLIPYVKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFINAAHQAGLNVILDWVPGHFPSDDFGLADFDGTKLYEHS
DPREGYHQDWNTLIYNYGRREVSNYLVGNALYWIERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRNTNRILGEQVSGAVSMAEESTDFAGVSRPQDMGGLGFWYK
WNLGWMHDTLDYMKLDPVHRQYHHDKLTFGMLYNYTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDAYGFEWLVVDDNERSVLIFVRRDKVGNEIIVASNFTPV
PRHDYRFGINQPGKWREIVNTDSMHYHGSNTGNGGVVHSDEIASHGRQHSLSLTLPPLAT
IWLVREGE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcgtatcgatagagacgtgattaatgcgctaattgcgggccattttgcggac
cctttttccgtacttggtatgcaccaaaccaccgcgggactggaagtccgcgccctattg
cctgatgccaccgaagtgtgggtgattgaaccgaaaaccggacgtaaagtcggcaaactg
gaatgtatcgactcacgcggtttttttagcggtgtgctcccccgacgcaaaaatttcttt
cgctatcagctcgctgttgtctggcatggacagcagaatctgattgacgatccttaccgt
tttggcccgctgatccaggaaatggatgcctggttactgtctgaaggcacgcatttacgc
ccgtatgaaacgctgggcgcacatgccgacacaatggacggcgttactggaacccgtttt
tccgtctgggcgccgaatgcccagcgcgtctccgtcgttgggcaattcaactactgggat
ggccgccgccacccgatgcgcctgcgcaaagaaagcggtatctgggagctgtttattccc
ggcgcgcaacacggtcagttgtacaagttcgagatgatcgatgcgcatggcaagctgaga
atcaaagccgacccgtatgcgtttgaagcgcaaatgcgcccggaaacggcctcgctgatc
tgcggtctaccggaaaaagtggtgcagacggaagagcgcaaacaagccaaccggttcgat
gcgccagtctccatctatgaagtgcatctgggctcgtggcgtcgtcataccgataacaat
ttctggctgagctaccgcgaactggcggatcagcttattccatacgtaaaatggatgggc
tttacccacctcgaactgcttcctgttaatgaacatccctttgatggcagctggggctac
cagccgaccgggctgtatgcgccgacccgccgtttcggcacgcgcgatgacttccgctat
ttcatcaatgccgctcatcaggcgggtctgaacgtcattcttgactgggtgccgggccac
ttcccgtcggatgattttggtctggcggatttcgatggcaccaaactgtatgagcacagc
gacccgcgcgaagggtatcaccaggactggaacacgcttatctataactacgggcgccgt
gaagtcagcaactatctggtcgggaacgcgctttactggattgagcgtttcggcattgat
gcgctgcgtgtagacgccgtggcgtcgatgatttaccgcgactacagccgcaaagaaggc
gagtggatccccaacgagttcggcgggcgtgagaacctggaagccattgagttcttacgc
aataccaaccgtattctgggagaacaggtgtctggcgcggtgagcatggccgaggagtcc
actgacttcgctggcgtgtcccgaccacaggatatgggcggactgggtttctggtacaaa
tggaacctgggctggatgcatgacacgctggactacatgaagctggacccggttcatcgc
cagtatcatcacgataagctgaccttcggcatgctctacaactacaccgaaaactttgtc
ctgccgctgtcgcatgacgaagtggtgcatggcaaaaaatcgattctcgaccgtatgcct
ggcgacgcctggcagaaattcgccaacctgcgcgcctattacggctggatgtgggcgttc
cccggtaagaaactgctgtttatgggcaacgagttcgcccaggggcgcgagtggaaccac
gacgccagccttgactggcatctgctggaaggcggcgacaactggcaccacggcgtacag
cggctggtgcgcgatctcaaccatacctatcgccaccataaagcgctgcatgaacttgat
tttgacgcttacggttttgaatggctggtggtggatgataacgaacgttcggtgctgatt
tttgtccgccgcgataaagtcggcaatgaaatcatcgtcgccagcaactttaccccggtg
ccgcgccatgactatcgttttggcatcaatcagccagggaaatggcgggagattgtgaat
accgactccatgcactaccacggcagcaataccggcaacggcggggtggtgcacagcgac
gagatcgccagccacggccgccagcactcattgagtctgacgctgccgccgctggccacc
atctggcttgtgcgggagggtgaatga

DBGET integrated database retrieval system