KEGG   Citrobacter koseri: CKO_04957Help
Entry
CKO_04957         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
cko  Citrobacter koseri
Brite
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CKO_04957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Haem_bd Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABV16001
UniProt: A8AR88
Position
complement(4542989..4544431)
Genome map
AA seq 480 aa AA seqDB search
MFIFWAIISHYSEGKIMKIITRLTAIAIAGIAICYLGLSGYVWYHDNQRSKEADVQASTL
EDNNKILGFLREKGCDYCHTPSAELPFYSSFPVAKQLMNYDIQLGYKSFNLEAVRAALVA
DKPVTQSDLNKIEWVMQYETMPPTRYTALHWAGKVSDTEREEILGWIAKQRERYYASADT
AAAHRNEPVQPVPEKLPVDDQKVALGFTLYHDARLSGDSTISCAHCHALNAGGVDGRKTS
IGVGGAVGPINAPTVFNSIFNVEQFWDGRAPTLQAQAGGPPLNPIEMASKSWDEIIGKLD
KDPVLKQQFTAIYPQGFSGETITDAIAEFEKTLITPNSPFDKWLRGDENALTAQQKHGYE
LFKENKCAACHGGIILGGRSFEPLGLKKDFNFGEITAADIGRMNVTNEVRDKLRQKVPGL
RNVALTAPYFHRGDVPTLDGAVKLMLRYQVGKEIPQKDIDDIVAFLESLNGVYTPYMQGK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgttcatcttctgggccataatatctcactatagtgagggtaaaataatgaaaatcatt
acccgtcttaccgcgatagccatagcaggcattgcgatttgttatttaggattatctggt
tacgtctggtatcacgataatcaacgtagtaaagaagctgatgtgcaagcctcaacgctg
gaagacaataataaaatcctgggttttttgcgggaaaagggatgcgattattgtcatacc
ccctctgctgaactgcctttttattcctcttttcccgttgctaagcagttgatgaattat
gacattcaactgggctataaatctttcaaccttgaagcagtacgcgccgcgttggtcgcg
gataaacccgtcacgcaaagcgatctgaataagattgaatgggtgatgcagtacgaaaca
atgccgccaacgcgctataccgcgctgcactgggccggtaaggtcagtgatacggagcgg
gaggagattctcggctggatcgctaaacagcgcgaacgttactacgccagcgcggatacg
gcggcggcgcaccgtaatgagccggttcagcctgtccccgaaaaactgccggttgacgat
caaaaagtcgcactgggttttaccctctaccacgatgcccgtttatcgggtgacagcacc
atctcctgcgcgcattgccatgcgctgaacgcgggcggcgtggacggcaggaaaacctcc
atcggcgtgggcggcgcggtagggccaatcaacgcgccaacggtgttcaactcgatcttt
aacgttgagcaattctgggatggtcgcgcaccgacgttgcaggcgcaggctggcgggccg
ccgttaaacccgattgaaatggcctctaaatcctgggatgaaattattgggaaactcgat
aaagacccggtgctaaaacagcagttcacggcgatatatccgcaaggcttcagcggagaa
acgattacggatgccattgccgagtttgagaagacgctgattacgccaaattcgcctttc
gataagtggttacgaggggatgaaaatgcgctgacggcgcagcagaaacatggctatgag
ctgttcaaagagaataaatgcgcggcctgtcacggcggtattattctcggtgggcgttcc
ttcgagccgttgggtctgaagaaagactttaatttcggcgaaattaccgctgcggacatt
ggacgtatgaacgtcaccaatgaagttcgcgataaattgcgtcagaaagtgccaggatta
cgtaacgttgcgctgaccgcgccgtatttccaccgtggagatgtgccaaccctcgacgga
gcggtgaaactgatgttgcgttatcaggtggggaaagagattccgcagaaagacattgat
gatattgtcgcgttcctggaaagcctgaacggggtgtatacgccgtatatgcaaggaaaa
taa

DBGET integrated database retrieval system