KEGG   Citrobacter koseri: CKO_05021Help
Entry
CKO_05021         CDS       T00592                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
cko  Citrobacter koseri
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CKO_05021
   00051 Fructose and mannose metabolism
    CKO_05021
Enzymes [BR:cko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     CKO_05021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4610050..4611384)
Genome map
AA seq 444 aa AA seqDB search
MEFIMQAYFDQLDRVRYEGPKSTNPLAFRHYNPDEIVLGKRMEDHLRFAACYWHTFCWNG
ADMFGVGAFNRPWQQPGDALELAKRKADVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYK
NNFAQMVDVLESKQEQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVNAMNA
THKLGGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKTGFQGTLLIEPKPQ
EPTKHQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIASAIALGIFGSVD
ANRGDAQLGWDTDQFPVSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGH
IGAMDTMALSLKVAARMIEDGELDKRVAKRYSGWNSELGQQILKGQLSLSDVAHYAEQRN
LAPVHQSGHQELLENLVNHYLFDK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggagttcattatgcaggcttattttgaccaactcgatcgtgttcgttatgaaggccct
aaaagcactaatccgttagctttccgccattataatccagatgaaatcgtactgggtaaa
cgcatggaagatcatctgcgttttgcggcctgctactggcataccttctgctggaacggc
gcggatatgtttggcgtaggcgcgttcaaccgtccgtggcaacagcccggcgatgcgctg
gagctggcgaagcgcaaggcggatgtggcgtttgaatttttccataagctgaacgtgcct
tactactgcttccacgatgtggatgtttcgccggaaggcgcctcgctgaaagagtataaa
aacaactttgcgcaaatggtcgatgtgctggagtcgaagcaagaacagagcggcgtgaag
ctgttatggggcaccgcgaactgctttaccaacccgcgttacggcgccggggcggcgacg
aacccggacccggaagtcttcagttgggcggcgacgcaggtggtgaacgcgatgaacgcc
acgcacaaactgggtggcgaaaactacgttctgtgggggggccgtgaagggtatgaaacc
ctgctgaataccgatctgcgccaggaacgcgagcagattggccgctttatgcagatggtg
gtggaacataaacataaaacaggtttccagggcacgctgctgatcgagccaaaaccgcag
gagccgacaaaacaccagtatgactacgatgtggcaacggtttacggcttcctcaagcag
ttcggcctggaaaaagagatcaaggtgaacattgaagccaaccacgctacgctggcgggc
cactctttccatcatgagattgcgtccgccattgcgctgggcatttttggttctgtggat
gccaaccgtggcgatgcgcagctgggctgggataccgaccagttcccggtaagcgtcgaa
gagaacgcgctggtgatgtatgaaatcctgaaagcgggcggtttcacgaccggcgggctg
aactttgacgcgaaggttcgtcgccagagcaccgacaaatacgatctgttctatggtcat
attggcgcgatggacacgatggcgctgtcattaaaagtggcagcgcgcatgattgaagat
ggcgaactggataaacgcgtggcgaaacgttattccggctggaatagcgaactgggccag
caaattttgaaaggccagttatccctgagcgacgtcgcgcactatgctgaacagcgtaat
ctggcgccggtgcatcaaagcggccatcaggaactgctggaaaatctggtgaatcattat
ctgttcgacaagtaa

DBGET integrated database retrieval system