KEGG   Citrobacter koseri ATCC BAA-895: CKO_05021Help
Entry
CKO_05021         CDS       T00592                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
cko  Citrobacter koseri ATCC BAA-895
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cko00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cko00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4610050..4611384)
Genome map
AA seq 444 aa AA seqDB search
MEFIMQAYFDQLDRVRYEGPKSTNPLAFRHYNPDEIVLGKRMEDHLRFAACYWHTFCWNG
ADMFGVGAFNRPWQQPGDALELAKRKADVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYK
NNFAQMVDVLESKQEQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVNAMNA
THKLGGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKTGFQGTLLIEPKPQ
EPTKHQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIASAIALGIFGSVD
ANRGDAQLGWDTDQFPVSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGH
IGAMDTMALSLKVAARMIEDGELDKRVAKRYSGWNSELGQQILKGQLSLSDVAHYAEQRN
LAPVHQSGHQELLENLVNHYLFDK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggagttcattatgcaggcttattttgaccaactcgatcgtgttcgttatgaaggccct
aaaagcactaatccgttagctttccgccattataatccagatgaaatcgtactgggtaaa
cgcatggaagatcatctgcgttttgcggcctgctactggcataccttctgctggaacggc
gcggatatgtttggcgtaggcgcgttcaaccgtccgtggcaacagcccggcgatgcgctg
gagctggcgaagcgcaaggcggatgtggcgtttgaatttttccataagctgaacgtgcct
tactactgcttccacgatgtggatgtttcgccggaaggcgcctcgctgaaagagtataaa
aacaactttgcgcaaatggtcgatgtgctggagtcgaagcaagaacagagcggcgtgaag
ctgttatggggcaccgcgaactgctttaccaacccgcgttacggcgccggggcggcgacg
aacccggacccggaagtcttcagttgggcggcgacgcaggtggtgaacgcgatgaacgcc
acgcacaaactgggtggcgaaaactacgttctgtgggggggccgtgaagggtatgaaacc
ctgctgaataccgatctgcgccaggaacgcgagcagattggccgctttatgcagatggtg
gtggaacataaacataaaacaggtttccagggcacgctgctgatcgagccaaaaccgcag
gagccgacaaaacaccagtatgactacgatgtggcaacggtttacggcttcctcaagcag
ttcggcctggaaaaagagatcaaggtgaacattgaagccaaccacgctacgctggcgggc
cactctttccatcatgagattgcgtccgccattgcgctgggcatttttggttctgtggat
gccaaccgtggcgatgcgcagctgggctgggataccgaccagttcccggtaagcgtcgaa
gagaacgcgctggtgatgtatgaaatcctgaaagcgggcggtttcacgaccggcgggctg
aactttgacgcgaaggttcgtcgccagagcaccgacaaatacgatctgttctatggtcat
attggcgcgatggacacgatggcgctgtcattaaaagtggcagcgcgcatgattgaagat
ggcgaactggataaacgcgtggcgaaacgttattccggctggaatagcgaactgggccag
caaattttgaaaggccagttatccctgagcgacgtcgcgcactatgctgaacagcgtaat
ctggcgccggtgcatcaaagcggccatcaggaactgctggaaaatctggtgaatcattat
ctgttcgacaagtaa

DBGET integrated database retrieval system