KEGG   Citrobacter koseri: CKO_05105Help
Entry
CKO_05105         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cko  Citrobacter koseri
Pathway
cko00230  Purine metabolism
cko01100  Metabolic pathways
Module
cko_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CKO_05105
Enzymes [BR:cko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CKO_05105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin MMR_HSR1 RsgA_GTPase AAA_33 AAA_16 AAA_22 ABC_tran Viral_helicase1 AAA_29 AAA_18
Motif
Other DBs
NCBI-ProteinID: ABV16148
UniProt: A8ARN5
Position
4685672..4686295
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRAPRPGEVHGEHYFFVDHH
EFKTMIGRDAFLEHAEVFGNYYGTSRETIEQVLATGVDVFLDIDWQGAQQIREKMPQARS
IFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALGDLK
TIIRAERLRMSRQKQRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcacgctttatattgtttctgcccccagtggcgcgggtaaatccagcctg
attcaggcgttgttaaaaacccaaccgttgtatgacacccaggtttctgtttcacacacc
acgcgcgcaccgcgtccgggtgaagtgcatggcgagcattatttctttgtcgatcatcat
gagttcaaaaccatgattggcagagatgcgtttctggagcacgctgaagtgtttggtaac
tattacggcacatcgcgtgaaaccattgagcaagtgctggcaacgggtgtggatgttttt
ctggatatcgactggcagggcgcacagcaaattcgtgagaagatgccgcaagcgcgcagt
atctttattttaccgccgtccaaaattgagctggaccgccgccttcgcgggcgcggtcag
gatagcgaagaagtaatcgcaaaacgtatggcgcaagctgttgcagaaatgagccattac
gccgaatatgattaccttattgtgaatgatgatttcgacaccgccctgggcgatctgaaa
accattattcgcgccgaacgtctgcgcatgagccgccaaaagcagcgtcatgacgcttta
atcagcaaactgttggcagactga

DBGET integrated database retrieval system