KEGG   Corynebacterium kroppenstedtii: ckrop_0009Help
Entry
ckrop_0009        CDS       T00896                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ckrop_0009 (rocF)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ckrop_0009 (rocF)
Enzymes [BR:ckp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     ckrop_0009 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(12048..12899)
Genome map
AA seq 283 aa AA seqDB search
MNTLRLLYPDFVSGGLDTYYFGAELLKHLLPQNDNQPWKTVPIDPPDDNQQLPTKNGIYG
LDTLTQGIHSAQSILDDNHPDRVITIGGSCLVSVAPFDYLHGVYDDVGIIWIDAHPDVSS
PADDYPYAHAMALSILLGDDSVPLSAELRNKPFPGDHILYVGLQDIFDYQRTVLENYQVP
YTVQSDQFLSTQAVSDFARRFDHLAVHFDIDVLNPRNFHSTYFANPNLTGDGSGGGSMTM
DQLQTILSAIDSAGPIDGLTIAEYLPFDEERLHATLRSLSIFQ
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacttcggctcctatacccagattttgttagcggcggactagacacttattac
tttggtgccgagctactgaaacatttacttccacagaatgacaatcagccttggaagaca
gtacccatcgatccgcccgatgataaccaacaattacccacaaagaacggtatttacggg
ctcgacaccctgacccaaggaattcactcagctcaatcaatcctggacgataatcaccca
gaccgggtcatcaccatcggcggaagctgcctagtttctgtcgctcccttcgattatctt
catggcgtctacgacgacgtcggaatcatctggatcgacgctcaccctgacgtatcctca
ccggccgatgactatccgtatgcccacgcgatggcattatcgattcttcttggtgacgat
tctgttccactgagcgccgaacttcggaataaaccatttcccggtgatcacatcctctac
gtcggcttgcaagatatcttcgattaccaacgcaccgtattagagaactaccaggtgccc
tatacggttcagagtgaccaattcttgtctacccaggcggtttcggactttgcccgccgg
tttgaccaccttgctgttcacttcgacatcgacgttctcaacccacggaatttccactcc
acctacttcgcgaaccccaacctcacaggtgatggttccggaggcggttcgatgacaatg
gatcagctccagaccatcctgtcagccatcgactccgcaggtccaatagatgggctcacg
atcgccgagtatttaccgtttgatgaggaacgtcttcacgcgacactccgatcactgtcc
atattccagtga

DBGET integrated database retrieval system