KEGG   Corynebacterium kroppenstedtii: ckrop_0009Help
Entry
ckrop_0009        CDS       T00896                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
ckp00220  Arginine biosynthesis
ckp00330  Arginine and proline metabolism
ckp01100  Metabolic pathways
ckp01110  Biosynthesis of secondary metabolites
ckp01130  Biosynthesis of antibiotics
ckp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    ckrop_0009 (rocF)
   00330 Arginine and proline metabolism
    ckrop_0009 (rocF)
Enzymes [BR:ckp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     ckrop_0009 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACR16808
UniProt: C4LGB8
Position
complement(12048..12899)
Genome map
AA seq 283 aa AA seqDB search
MNTLRLLYPDFVSGGLDTYYFGAELLKHLLPQNDNQPWKTVPIDPPDDNQQLPTKNGIYG
LDTLTQGIHSAQSILDDNHPDRVITIGGSCLVSVAPFDYLHGVYDDVGIIWIDAHPDVSS
PADDYPYAHAMALSILLGDDSVPLSAELRNKPFPGDHILYVGLQDIFDYQRTVLENYQVP
YTVQSDQFLSTQAVSDFARRFDHLAVHFDIDVLNPRNFHSTYFANPNLTGDGSGGGSMTM
DQLQTILSAIDSAGPIDGLTIAEYLPFDEERLHATLRSLSIFQ
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacttcggctcctatacccagattttgttagcggcggactagacacttattac
tttggtgccgagctactgaaacatttacttccacagaatgacaatcagccttggaagaca
gtacccatcgatccgcccgatgataaccaacaattacccacaaagaacggtatttacggg
ctcgacaccctgacccaaggaattcactcagctcaatcaatcctggacgataatcaccca
gaccgggtcatcaccatcggcggaagctgcctagtttctgtcgctcccttcgattatctt
catggcgtctacgacgacgtcggaatcatctggatcgacgctcaccctgacgtatcctca
ccggccgatgactatccgtatgcccacgcgatggcattatcgattcttcttggtgacgat
tctgttccactgagcgccgaacttcggaataaaccatttcccggtgatcacatcctctac
gtcggcttgcaagatatcttcgattaccaacgcaccgtattagagaactaccaggtgccc
tatacggttcagagtgaccaattcttgtctacccaggcggtttcggactttgcccgccgg
tttgaccaccttgctgttcacttcgacatcgacgttctcaacccacggaatttccactcc
acctacttcgcgaaccccaacctcacaggtgatggttccggaggcggttcgatgacaatg
gatcagctccagaccatcctgtcagccatcgactccgcaggtccaatagatgggctcacg
atcgccgagtatttaccgtttgatgaggaacgtcttcacgcgacactccgatcactgtcc
atattccagtga

DBGET integrated database retrieval system