KEGG   Corynebacterium kroppenstedtii: ckrop_0257Help
Entry
ckrop_0257        CDS       T00896                                 

Gene name
fadB1
Definition
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ckrop_0257 (fadB1)
   01212 Fatty acid metabolism
    ckrop_0257 (fadB1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ckrop_0257 (fadB1)
   00650 Butanoate metabolism
    ckrop_0257 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    ckrop_0257 (fadB1)
   01040 Biosynthesis of unsaturated fatty acids
    ckrop_0257 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ckrop_0257 (fadB1)
   00310 Lysine degradation
    ckrop_0257 (fadB1)
   00380 Tryptophan metabolism
    ckrop_0257 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ckrop_0257 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ckrop_0257 (fadB1)
   00281 Geraniol degradation
    ckrop_0257 (fadB1)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    ckrop_0257 (fadB1)
Enzymes [BR:ckp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ckrop_0257 (fadB1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ckrop_0257 (fadB1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ckrop_0257 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(318448..320721)
Genome map
AA seq 757 aa AA seqDB search
MTNTTIHWDTDDSGIVTLTMDDPASPVNTMNDAFRASLHDTVEKLTAAVEDKTVTGVIIT
SAKKTFFAGGDITSMINTGPDDAQATYDMLTSMKKDLRALETLGVPVVAAINGAALGGGL
EIALSCHYRIAADAKGSKIGLPEVTLGLLPGGGGVTRTVRMLGIQEALMSVLTTGKRMRP
EQAKGLGLIDDVVAPDALTDAAREWLASNPEPSQPWDREGYRIPGGTPTSPKLASILPSF
PATVTKQIKGAPMPAPKAILSAAVEGAQVDFDHALDIETRYFVELVTGPIATNMMQAFFF
DLQHCNGGGSRPKDVEKKKFRKLGMVGAGMMGAGIAYVAAKAGLEVALKDVELANAERGK
AYSEGLEKKALDRGRTTAEKSQALLDRITPTADYADLADCDIVIEAVFENTELKHKVWAE
IEEAVPDDCLLGSNTSTLPITGLAEGVNRPQNFIGIHFFSPVDKMPLIEVIKGDKTDDET
LAGALDFAQQIRKTPIVVNDSRGFYTSRVIGFMLDESLRMLAEGIDPAVIEAAGRQAGYP
APPLQLTDELNLKLVRKINTENAKAAEAAGIEIDDGGVGTIVDAMLDDYDRPGKLEGRGF
YTYTDGKRTGLWDGLWTELGAGRVSIGDYETKVSDGDHVGRRGDAPNQPSEGAPTFADLR
ERILFAEALETQKCVDEGVLMDDADANIGSIMGIGFPAWTGGTRQFIKNYARPEDADLPE
NAGDDYPTRGIPGFVARARELAAKYGERFEPMESLTQ
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacacaacgatccactgggacaccgacgattccggcatcgtcaccctgaccatg
gacgaccccgcctcgcccgtaaacacaatgaacgacgcgttccgcgcgagccttcacgac
accgtggagaaactcaccgcggccgtcgaggacaagaccgtcacgggcgtcattattacg
tctgcgaagaaaacgttcttcgccggtggcgatatcacctccatgattaacaccggcccc
gacgacgcccaagccacctacgacatgctgaccagcatgaaaaaggatcttcgcgcgctg
gaaacgctcggcgtgcccgttgtcgccgccattaacggtgcggctctcgggggcgggtta
gaaatcgcgttgagctgccactatcgcatcgctgccgacgccaaaggctccaagattggc
cttcccgaagtgaccctcggactcctccctggtggtggcggagtgacacgcaccgtccgc
atgctgggcattcaagaggcactcatgtcggtgctcaccaccggcaagcgcatgcgccct
gaacaggcgaaaggtctcggccttatcgacgatgtcgtcgccccagacgcgcttaccgac
gccgcacgcgagtggctggccagcaaccctgagccctcacaaccatgggaccgggagggc
taccgcatcccgggcggaacccccacatcgcccaagctagcgagcattcttccgtccttc
cccgcgaccgtgaccaagcagatcaagggcgcacccatgcccgcgccgaaggcaatcctg
tccgcagcggttgagggggcacaggtggatttcgatcacgccctcgacatagaaactcga
tacttcgttgagctggtcaccggccccatcgcgaccaatatgatgcaggcatttttcttc
gatctgcagcactgtaatggtgggggctcgcgtcccaaggacgtcgagaagaaaaagttt
agaaagctgggcatggtcggcgcgggaatgatgggcgccggcatcgcctatgtggcagca
aaagcagggctcgaggtcgcgctgaaggacgtcgaactcgccaatgccgaacgcggaaag
gcctactcagaggggctggagaagaaggcactggaccgggggcgtaccaccgccgaaaaa
tcgcaagcactcctggaccgcatcacgccgacggccgactacgccgaccttgccgattgc
gacatcgtcatcgaagcagtcttcgaaaacaccgagctcaagcacaaagtgtgggccgaa
atcgaagaagccgtccctgacgattgcctcctcggatccaacacctcgacgctgccgatc
acgggcctcgccgagggcgtcaaccgcccccagaacttcatcggcatccacttcttctcc
cccgtcgacaagatgccgctcatcgaggtcatcaagggcgacaagacggacgacgagact
ctcgccggggcgctcgactttgcgcaacaaatccgcaagacgcccatcgtcgtcaatgat
tctcgtgggttctacacatcgcgcgtgatcgggttcatgctggatgaatcgctgcggatg
ctcgccgagggcatcgatccagcggtcatcgaagcggcaggtcgtcaagccggctaccct
gcaccgccactgcagctcactgacgaactcaacctcaagctcgtgcgcaagatcaacacc
gagaatgccaaggccgccgaagcagccggtattgagattgacgacggaggcgtcggcacg
attgtcgatgccatgctcgacgactatgaccggccgggcaaactcgaagggcgcgggttt
tacacctacaccgacgggaagcgcaccggcctgtgggatggactgtggactgagctgggt
gccggtcgcgtgtccatcggcgactacgaaaccaaggtgtctgacggcgaccacgtcggg
cgacgcggcgatgcccctaaccagccgtccgagggtgcccccaccttcgctgacctgcgg
gaacggattctcttcgccgaagcgctggaaacgcagaaatgcgtcgacgagggtgtgctg
atggacgatgccgacgccaacatcggctcgatcatggggatcggattcccggcatggaca
ggtgggacgcggcagttcatcaagaattacgctcggcctgaggatgctgacctccccgag
aatgcgggggacgactaccccacccgcggcatccctggattcgtcgcacgcgcgcgtgaa
ctcgccgcgaaatacggggaacgcttcgagcctatggagtcattgacgcagtga

DBGET integrated database retrieval system