KEGG   Corynebacterium kroppenstedtii: ckrop_0375Help
Entry
ckrop_0375        CDS       T00896                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ckrop_0375
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ckrop_0375
Enzymes [BR:ckp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ckrop_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
460619..461107
Genome map
AA seq 162 aa AA seqDB search
MSIYDIPVTTIEGKETTLRSWEGHVLLIVNVASECGFTPQYEALEHIFEEYAARGFFVIG
VPCNQFGEQEPGSNEEIKEFASSKFGVTFPLLSKTDVNGDNEHPLYTELKKTADNNGEAG
DVKWNFEKFVLSDSGEVLGRFRSDVDPEDDALLDLIEDNLPL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttatgacatcccagtaacgacgatcgagggtaaagaaacaacattgcgctcg
tgggaaggccacgttcttttaattgtgaacgtcgctagcgagtgtggttttacgccgcaa
tatgaagctctcgagcacattttcgaggaatacgcggcgcggggcttcttcgtcatcggc
gttccctgcaaccagttcggtgagcaagagcccggctcgaatgaggagatcaaggagttc
gcgtcttcgaaatttggtgtgacattcccgctgctcagcaagacggatgtgaatggggac
aatgagcacccgctctacaccgagttgaagaaaaccgctgataacaatggcgaagcgggc
gacgtgaagtggaactttgagaaatttgttctgtcggattcgggggaggtcctgggtcgg
ttccgcagcgacgtcgatcccgaagatgatgcccttctggatctgattgaggacaacctc
cctctctag

DBGET integrated database retrieval system