KEGG   Corynebacterium kroppenstedtii: ckrop_0402Help
Entry
ckrop_0402        CDS       T00896                                 

Gene name
deoD
Definition
purine nucleoside phosphorylase (EC:2.4.2.1)
Orthology
K03784  
purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ckp00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ckp00240]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ckp00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492251..492967
Genome map
AA seq 238 aa AA seqDB search
MGRQSTPHINPNGVPIAETILLPGDPLRAKFIAETYLDDAVQFNSVRNAFGYTGTYQGKE
VSVMGSGMGIPSISLYAWELIHDFGVKKLVRVGSCGSLQKDLNLYDVVIGQAACTDSNFL
SQYNLPGVYAPIASYRLIEDVRTRAKEAGITTHVGNVLSSDVFYNYQDDVNQRWAAMGVL
AVEMESAGLYATAAEAGVEALGIFTVSDNIVTGEATTASEREKAFTTMMELALPLAAI
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgggccgacaatcaactccgcatatcaacccgaacggcgtacccatcgccgaaacgatc
ctcctgcccggcgacccgctccgcgcaaaattcatcgcagagacctacctcgacgacgcc
gtccagttcaactccgtccgcaacgccttcggatacaccggcacctaccagggcaaagaa
gtctcagtgatggggtcggggatgggcatcccctccatctccctctacgcctgggagctc
atccacgacttcggtgtgaaaaagctcgtccgcgtcggctcatgtggctcactgcagaag
gatctcaatctttacgacgtcgtcattgggcaagctgcctgcaccgactcgaatttcctg
tcccagtacaacctgcccggggtgtatgcaccgatcgcctcataccggctaattgaggac
gtccgaacccgtgcgaaggaagccggaatcaccacccacgtgggcaacgtcctgagctcc
gatgtgttctacaactaccaggacgacgtcaaccaacggtgggccgcaatgggtgtcctc
gccgtggaaatggaatctgccgggttgtatgccaccgccgcagaagcaggcgtcgaagcg
ctggggattttcaccgtcagcgacaacatcgtgacgggcgaggccaccaccgctagtgaa
cgggaaaaagcatttaccaccatgatggagctcgcgcttccactcgcggcgatctaa

DBGET integrated database retrieval system