KEGG   Corynebacterium kroppenstedtii: ckrop_0402Help
Entry
ckrop_0402        CDS       T00896                                 

Gene name
deoD
Definition
(GenBank) purine nucleoside phosphorylase
  KO
K03784  purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
ckp00230  Purine metabolism
ckp00240  Pyrimidine metabolism
ckp00760  Nicotinate and nicotinamide metabolism
ckp01100  Metabolic pathways
ckp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ckrop_0402 (deoD)
   00240 Pyrimidine metabolism
    ckrop_0402 (deoD)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ckrop_0402 (deoD)
Enzymes [BR:ckp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     ckrop_0402 (deoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: ACR17181
UniProt: C4LH76
Position
492251..492967
Genome map
AA seq 238 aa AA seqDB search
MGRQSTPHINPNGVPIAETILLPGDPLRAKFIAETYLDDAVQFNSVRNAFGYTGTYQGKE
VSVMGSGMGIPSISLYAWELIHDFGVKKLVRVGSCGSLQKDLNLYDVVIGQAACTDSNFL
SQYNLPGVYAPIASYRLIEDVRTRAKEAGITTHVGNVLSSDVFYNYQDDVNQRWAAMGVL
AVEMESAGLYATAAEAGVEALGIFTVSDNIVTGEATTASEREKAFTTMMELALPLAAI
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgggccgacaatcaactccgcatatcaacccgaacggcgtacccatcgccgaaacgatc
ctcctgcccggcgacccgctccgcgcaaaattcatcgcagagacctacctcgacgacgcc
gtccagttcaactccgtccgcaacgccttcggatacaccggcacctaccagggcaaagaa
gtctcagtgatggggtcggggatgggcatcccctccatctccctctacgcctgggagctc
atccacgacttcggtgtgaaaaagctcgtccgcgtcggctcatgtggctcactgcagaag
gatctcaatctttacgacgtcgtcattgggcaagctgcctgcaccgactcgaatttcctg
tcccagtacaacctgcccggggtgtatgcaccgatcgcctcataccggctaattgaggac
gtccgaacccgtgcgaaggaagccggaatcaccacccacgtgggcaacgtcctgagctcc
gatgtgttctacaactaccaggacgacgtcaaccaacggtgggccgcaatgggtgtcctc
gccgtggaaatggaatctgccgggttgtatgccaccgccgcagaagcaggcgtcgaagcg
ctggggattttcaccgtcagcgacaacatcgtgacgggcgaggccaccaccgctagtgaa
cgggaaaaagcatttaccaccatgatggagctcgcgcttccactcgcggcgatctaa

DBGET integrated database retrieval system