KEGG   Corynebacterium kroppenstedtii: ckrop_0451Help
Entry
ckrop_0451        CDS       T00896                                 

Gene name
echA2
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ckrop_0451 (echA2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ckrop_0451 (echA2)
   00650 Butanoate metabolism
    ckrop_0451 (echA2)
  Lipid metabolism
   00071 Fatty acid degradation
    ckrop_0451 (echA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ckrop_0451 (echA2)
   00310 Lysine degradation
    ckrop_0451 (echA2)
   00360 Phenylalanine metabolism
    ckrop_0451 (echA2)
   00380 Tryptophan metabolism
    ckrop_0451 (echA2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ckrop_0451 (echA2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ckrop_0451 (echA2)
   00281 Geraniol degradation
    ckrop_0451 (echA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ckrop_0451 (echA2)
   00627 Aminobenzoate degradation
    ckrop_0451 (echA2)
   00930 Caprolactam degradation
    ckrop_0451 (echA2)
Enzymes [BR:ckp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ckrop_0451 (echA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
551655..552515
Genome map
AA seq 286 aa AA seqDB search
MTNENNVTSASPDGEVTLDILPVDNDTPTDGEPQPRVAVITIRRDHKRNSLNADVCSQIA
TYVHEAENTDSVRAILLRGEGKAFCAGADLAGGVYTSAFHHNLDAMLTSITHSPLPVIAD
VHGPAVGAGTQLAMACDLRVVGESGWFSVPVVRLGIAVDPWTIHRAVELLGGARARSFLY
TAERLEPDAAISAGLASSRGNHDDAWQVAVDQATNAPLTLRYLKAVFNQVVPTGVAQGGS
SEGTGHDDEVLTAVHERLRTECWDSDDAAEARAARSEKRSSVFKGK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgagaacaatgtcacatctgcatcacccgacggcgaggtcactttagacatc
ctgcccgtggataacgacactccaaccgatggcgagccacagccacgggtggcagtcatt
acgatccgtcgcgatcacaagagaaactcgctgaacgccgacgtctgcagccagatcgcg
acatatgttcacgaggcggaaaatacggactcagttcgcgccatccttctccgcggggag
gggaaggctttttgcgccggagcagacctcgccggcggcgtgtacacatcagctttccat
cacaatctcgatgcaatgctgacctctattactcattcgcctctccccgttattgccgac
gtccacggcccggcggtcggtgcgggcacccagctggcgatggcgtgcgacctccgcgtc
gtgggggagagcggctggttcagcgttcctgtcgttcgcctaggcatcgccgtcgatccg
tggacgatccatcgcgccgtcgaattactcggcggtgcccgggcgcggtccttcctctac
acggctgagcgactcgagcccgacgctgcgatatcagcagggttggcgtcgtcacgagga
aaccacgacgacgcctggcaggtcgccgtcgatcaagccacgaatgctccgctgaccttg
aggtatctcaaagccgtctttaatcaggtagttccgacgggggtggcccagggtggttcc
tccgaggggactggtcatgacgacgaggtgctcaccgctgttcatgagcgcttgcgcaca
gagtgttgggattccgacgatgctgccgaggcaagggctgcgcggtccgaaaaacgttcc
tcggtgtttaagggcaaatag

DBGET integrated database retrieval system