KEGG   Corynebacterium kroppenstedtii: ckrop_0460Help
Entry
ckrop_0460        CDS       T00896                                 

Gene name
folA
Definition
bifunctional dihydrofolate reductase-thymidylate synthase (EC:2.1.1.45)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ckrop_0460 (folA)
   00670 One carbon pool by folate
    ckrop_0460 (folA)
Enzymes [BR:ckp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ckrop_0460 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(561476..562141)
Genome map
AA seq 221 aa AA seqDB search
MSTSSSTGVHSPTSGDASPSPRRTVEPEQPLIGVIWASDRDGVIGDGTRMPWHVPEDMAH
FKQLTWGVPVIMGSATWSSIPSRFTPLPGRTNIVLSRRWSDEDTPDGVILHHSLDAAFKD
IPHPVFTRRVAPENVDAWVIGGGEVYREALTRPEVRLAVLTEIDAAVGHYFDRPVTARLS
SEWVPSSRSEWKTSRNGTIIGDGNDGRDTQPLRYRFCYFSK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtctacttcatcttccacaggcgttcactcgcccactagtggcgacgcttccccgtcc
ccacgtcgaacagtggaacccgaacagccactcatcggggttatctgggcctccgatagg
gacggggtcattggcgacggcacacgaatgccgtggcacgtccccgaagacatggcacac
ttcaaacagctgacatggggagtgcccgtcatcatgggcagcgcaacgtggtcaagtatt
ccctcgcgtttcacgccactgcctgggcgtaccaatatcgttctctcccgacgctggagt
gacgaggacacccccgacggcgtcatccttcaccattcgttggacgcagcgttcaaggat
attccccacccggtgttcacccggcgcgtcgcaccggaaaatgtggacgcatgggtcatt
ggcgggggcgaagtttaccgggaggccctcacccgccccgaggtccggctggccgttctc
acggaaattgacgcggctgttgggcactatttcgaccgtcccgttactgcccgattgtcg
tcggagtgggtgccgtcgtcgcgcagtgagtggaaaacgtcccgcaatggaacgatcatc
ggtgatggcaacgatggccgcgacacccagccacttcgctatcggttctgctatttcagc
aagtaa

DBGET integrated database retrieval system