KEGG   Corynebacterium kroppenstedtii: ckrop_0462Help
Entry
ckrop_0462        CDS       T00896                                 

Gene name
cysQ
Definition
inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ckp00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(563080..563985)
Genome map
AA seq 301 aa AA seqDB search
MTTRCPSDTTCPRRQSSVIHQASPGARLDRDRSRPRGGDKRLTTAKVVYVSAYVDDATLA
LRLATGTSEILKGVRSVGLLEGPGLGAAGDDLAQTWIERVLSRHRPDDGFLSEEAADSLE
RLKKNRVWIVDPLDGTKEFAGGRQDWAIHVALVENGIPTHAAVGLPDAGQVFHTGSAKAV
MGPRANKIVVSHNRQPEVAQVIADKLDSEVVRMGSAGAKAMHVLLGDYDAYVHAGGQYEW
DSAAPIGVCTDAGLHCSRLDGSPLRYNNEDVYLPDVVICRPELKDTILEAAAEFKKEHGH
Y
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgagatgcccttccgacacgacgtgcccacgtcgtcaatccagcgtgatccat
caagcgagccccggggcacgcttagaccgagaccgatcccgcccccgtggtggagacaaa
cgactgacaacggctaaagtcgtctacgtgagtgcttacgttgacgatgccacccttgcc
ctgcgccttgcgacgggaactagtgagatcctgaagggcgtccgttccgtcggtttgctt
gaaggacctggcctcggcgcggcgggtgatgacttagcccagacgtggattgagcgcgta
ctctcccgtcaccgccccgatgatggttttttgtcagaggaagccgcagatagcttagag
cggctgaagaaaaaccgcgtgtggatcgtcgaccctctcgacggcaccaaggagtttgcc
ggcggacgccaggactgggcaatccatgttgcactcgtagaaaatggcattccgacgcat
gctgctgtcggacttcccgacgctggccaggtcttccatactggttcagccaaggctgtg
atgggcccgcgggctaacaagatcgttgtgtcgcacaaccgtcagcctgaggtcgcgcag
gtcattgccgacaagctcgacagtgaagttgttcgcatgggctctgctggtgcgaaagcc
atgcacgtgctgctcggcgactatgacgcctatgtccatgctggtggccagtacgagtgg
gactctgcagccccgatcggtgtgtgcacggacgctggcctgcactgctctcgtctcgat
ggttcgccgctgcggtacaacaacgaggatgtctatcttcccgatgttgttatttgccgc
ccggagttgaaggacaccattttggaggctgccgccgagttcaagaaagagcacggccac
tactaa

DBGET integrated database retrieval system