KEGG   Corynebacterium kroppenstedtii: ckrop_0476Help
Entry
ckrop_0476        CDS       T00896                                 

Gene name
fadA2
Definition
(GenBank) acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
ckp00071  Fatty acid degradation
ckp00072  Synthesis and degradation of ketone bodies
ckp00280  Valine, leucine and isoleucine degradation
ckp00310  Lysine degradation
ckp00362  Benzoate degradation
ckp00380  Tryptophan metabolism
ckp00620  Pyruvate metabolism
ckp00630  Glyoxylate and dicarboxylate metabolism
ckp00640  Propanoate metabolism
ckp00650  Butanoate metabolism
ckp00900  Terpenoid backbone biosynthesis
ckp01100  Metabolic pathways
ckp01110  Biosynthesis of secondary metabolites
ckp01120  Microbial metabolism in diverse environments
ckp01130  Biosynthesis of antibiotics
ckp01200  Carbon metabolism
ckp01212  Fatty acid metabolism
ckp02020  Two-component system
Module
ckp_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ckrop_0476 (fadA2)
   00630 Glyoxylate and dicarboxylate metabolism
    ckrop_0476 (fadA2)
   00640 Propanoate metabolism
    ckrop_0476 (fadA2)
   00650 Butanoate metabolism
    ckrop_0476 (fadA2)
  Lipid metabolism
   00071 Fatty acid degradation
    ckrop_0476 (fadA2)
   00072 Synthesis and degradation of ketone bodies
    ckrop_0476 (fadA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ckrop_0476 (fadA2)
   00310 Lysine degradation
    ckrop_0476 (fadA2)
   00380 Tryptophan metabolism
    ckrop_0476 (fadA2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ckrop_0476 (fadA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ckrop_0476 (fadA2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ckrop_0476 (fadA2)
Enzymes [BR:ckp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ckrop_0476 (fadA2)
Exosome [BR:ckp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ckrop_0476 (fadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Cas_NE0113
Motif
Other DBs
NCBI-ProteinID: ACR17252
UniProt: C4LHE7
Position
581133..582347
Genome map
AA seq 404 aa AA seqDB search
MSDSHASCQLRPDDVVIVGAKRTPQGKLLGALASQTSVDLGAAAVSSALKDSGVASGDVD
YVVMGQVLLAGAGQNPARQVAVKSGIPLDVPAEIVNKVCLSGLDAIIHATRMIRVGDASI
VVAGGMESMTNAPHIAAGVRQGKTYGDLRLVDAINRDGLHDAVSGKTMGEETDRGNQDRG
ITREEQDHIAALSHQRAEKARDEGLFDDEIVPIEIPQRKGDPVVVRADEGIRPGTTEEGL
SRLRPAFLEGGTITAASSSQISDGAAAVVLTTREEAEKRELRVLAVIGQYGQTAGPDTTQ
LHSQPSRALKSALDRSGWSIDDLDVIEINEAFAAVVAQSIKDLGVDMDRVNVNGGGIALG
HPVGASGARLVVHMAHELDRRGGGRAGVSLCGGGGQGDALTLWV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattcccacgcctcatgccaactccgcccagacgatgtcgtcattgtgggggcg
aagcgcaccccgcaggggaaattactgggagccttggcgtcgcaaacgtcggttgacctc
ggggctgcggcggtgtcgtcggcactgaaagactccggtgttgccagcggggacgtggat
tatgtcgtgatgggccaggttctgctggcaggggcggggcagaatccggctcgccaggtg
gcggtgaagtccggtattccgctggacgttccggccgagatcgtcaacaaggtgtgcttg
tccggcctggacgcgattattcacgcaacgcgcatgatccgtgtgggggacgcatcgatc
gtcgtcgccggaggtatggagtccatgacgaacgctccgcatattgctgcgggcgtgcgt
caggggaagacttatggtgatttacggcttgtcgacgcgattaaccgcgacggccttcac
gatgctgtgagcgggaaaacgatgggggaggagactgaccgggggaatcaggaccgtggg
attacccgcgaagagcaagaccacattgcggccctgtcccaccagcgggctgagaaagcg
cgagatgagggtctgtttgatgatgagattgttccgatagagatcccgcagcgtaagggt
gatcccgtcgtggttcgtgccgatgagggcattaggcctggtacgacggaagagggatta
tcgcggcttcgtcctgctttcctggaaggcgggacgattacagcggcgagttcatcgcaa
atttccgacggtgctgcagccgtcgtgctcaccactcgtgaggaagctgagaagagggaa
ctccgggttctggctgttattgggcagtatggccaaacggcggggccggatacgacgcag
ttacactctcaaccatcgcgcgcgttgaaatctgcgcttgaccggtcgggatggtcaatt
gacgatctcgacgtcattgagatcaatgaagcttttgccgctgttgttgcccagtccatt
aaggacctaggggtggacatggaccgcgtcaatgtcaatgggggaggtatcgctttgggg
catccagttggtgcgtcgggagcgcgcctggttgttcacatggcccatgagctcgatcga
cgaggtggcgggcgcgccggtgtgagcttgtgtggcggcggtggtcagggtgatgccttg
acgctgtgggtgtaa

DBGET integrated database retrieval system