KEGG   Corynebacterium kroppenstedtii: ckrop_0491Help
Entry
ckrop_0491        CDS       T00896                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ckrop_0491 (galU)
   00052 Galactose metabolism
    ckrop_0491 (galU)
   00500 Starch and sucrose metabolism
    ckrop_0491 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ckrop_0491 (galU)
Enzymes [BR:ckp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ckrop_0491 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
592028..592951
Genome map
AA seq 307 aa AA seqDB search
MAPMNKDDNGGNGQAALRTVIVPAAGLGTRFLPATKTVPKELLPVVDRPGIELIAEEARE
AGASRLAIVTSPRKSGLMKHFDHDDLLEETLKKRGKEDRLQKVQHSTELIDAVSVTQERP
LGLGHAVAQAEEVLDPDEDVVAVMLPDDLVMPYGVMNKMLEVRAKYGGSVLCAVDVDKEA
TSDYGVFEVSGQPDDDVYAVSGMVEKPEPEDAPSTLAATGRYLLDRDIFKALGKIEPGKG
GELQLTDAIELLIKSDHPVHVVVHRGPRHDLGNPGGFIKACVDFGLRDPEYGDSLRAYMT
ERLAQDS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggctcctatgaacaaagatgataatggcggaaatggtcaggctgcgttgcgtacagtc
atcgtgccagccgctggtttgggtacccgtttccttccggcgacgaagaccgtacccaaa
gagcttctcccggttgttgaccggcccggtatcgagctcattgcggaggaagcccgcgag
gctggcgcttcacgcttggctatcgttacctccccgcgcaagtcagggctgatgaagcac
ttcgaccatgatgatctcctggaagagacactcaagaagcgcggcaaagaggatcggctg
cagaaagtgcagcactcgaccgaacttatcgacgctgtttcggtcactcaggagcgcccc
ttagggcttggtcatgccgtcgctcaggctgaagaggttcttgatcccgacgaagacgtc
gtggccgtcatgcttcccgatgaccttgtcatgccctatggtgtcatgaacaagatgctt
gaggtccgcgcaaaatacggcggatctgtgctctgcgcggtggacgtcgataaggaagca
acctctgactacggggttttcgaggtcagcggtcaacccgatgatgatgtctacgccgtt
tcgggcatggttgaaaagcctgaaccggaagacgcaccctcgacgctggcggcaaccggc
cgttacctgttggatcgcgatattttcaaggcgctgggtaagatcgagcccggtaagggc
ggcgaactgcagctcacagatgccattgagctgctcatcaagtcggatcaccccgtgcat
gtggtggttcaccgtggccctcgccacgatttgggcaacccgggtgggttcatcaaggcc
tgtgttgacttcggcctgagggatcccgagtatggcgactcgctgagggcgtatatgacg
gaaaggttggcccaggacagctag

DBGET integrated database retrieval system