KEGG   Corynebacterium kroppenstedtii: ckrop_0491Help
Entry
ckrop_0491        CDS       T00896                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
ckp00040  Pentose and glucuronate interconversions
ckp00052  Galactose metabolism
ckp00500  Starch and sucrose metabolism
ckp00520  Amino sugar and nucleotide sugar metabolism
ckp01100  Metabolic pathways
ckp01130  Biosynthesis of antibiotics
Module
ckp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ckrop_0491 (galU)
   00052 Galactose metabolism
    ckrop_0491 (galU)
   00500 Starch and sucrose metabolism
    ckrop_0491 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ckrop_0491 (galU)
Enzymes [BR:ckp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ckrop_0491 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACR17266
UniProt: C4LHG1
Position
592028..592951
Genome map
AA seq 307 aa AA seqDB search
MAPMNKDDNGGNGQAALRTVIVPAAGLGTRFLPATKTVPKELLPVVDRPGIELIAEEARE
AGASRLAIVTSPRKSGLMKHFDHDDLLEETLKKRGKEDRLQKVQHSTELIDAVSVTQERP
LGLGHAVAQAEEVLDPDEDVVAVMLPDDLVMPYGVMNKMLEVRAKYGGSVLCAVDVDKEA
TSDYGVFEVSGQPDDDVYAVSGMVEKPEPEDAPSTLAATGRYLLDRDIFKALGKIEPGKG
GELQLTDAIELLIKSDHPVHVVVHRGPRHDLGNPGGFIKACVDFGLRDPEYGDSLRAYMT
ERLAQDS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggctcctatgaacaaagatgataatggcggaaatggtcaggctgcgttgcgtacagtc
atcgtgccagccgctggtttgggtacccgtttccttccggcgacgaagaccgtacccaaa
gagcttctcccggttgttgaccggcccggtatcgagctcattgcggaggaagcccgcgag
gctggcgcttcacgcttggctatcgttacctccccgcgcaagtcagggctgatgaagcac
ttcgaccatgatgatctcctggaagagacactcaagaagcgcggcaaagaggatcggctg
cagaaagtgcagcactcgaccgaacttatcgacgctgtttcggtcactcaggagcgcccc
ttagggcttggtcatgccgtcgctcaggctgaagaggttcttgatcccgacgaagacgtc
gtggccgtcatgcttcccgatgaccttgtcatgccctatggtgtcatgaacaagatgctt
gaggtccgcgcaaaatacggcggatctgtgctctgcgcggtggacgtcgataaggaagca
acctctgactacggggttttcgaggtcagcggtcaacccgatgatgatgtctacgccgtt
tcgggcatggttgaaaagcctgaaccggaagacgcaccctcgacgctggcggcaaccggc
cgttacctgttggatcgcgatattttcaaggcgctgggtaagatcgagcccggtaagggc
ggcgaactgcagctcacagatgccattgagctgctcatcaagtcggatcaccccgtgcat
gtggtggttcaccgtggccctcgccacgatttgggcaacccgggtgggttcatcaaggcc
tgtgttgacttcggcctgagggatcccgagtatggcgactcgctgagggcgtatatgacg
gaaaggttggcccaggacagctag

DBGET integrated database retrieval system