KEGG   Corynebacterium kroppenstedtii: ckrop_0518Help
Entry
ckrop_0518        CDS       T00896                                 

Gene name
metS
Definition
methionyl-tRNA synthetase (EC:6.1.1.10)
Orthology
K01874  
methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Selenocompound metabolism
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:ckp00450]
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:ckp00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
618986..620824
Genome map
AA seq 612 aa AA seqDB search
MSAPILTSVAWPYANGPRHIGHVAGFGVPSDVFARYQRMRGRDVLMVSGTDEHGTPLLVQ
AEKEGVSVQQLADTYNKQIVEDLAGLGLSYDLFTRTTTRNHYAIVQELFTTLYSNGYMVK
QTTLGAISPSTGRTLPDRYIEGTCPICGAPGARGDQCDTCGNQLDPADLIDSVSKINGET
PKFVETEHFLLDLPALADALGEWLESRQDWRPNVLKFSLNILKDIKPRAMTRDIDWGVPV
PLEGWADNKFKKLYVWFDAVVGYLSASIEWAHRIGDPDAWKKWWTNPEAKSYYFMGKDNI
TFHSQIWPAEMLGYRGLGSRGGTEGKLGDLQLPTEVVSSEYLTMSGSKFSSSKGVVIYVQ
DFLREFGPDPLRYFIAVAGPENNDTDFTWDEFVRRNNNELANSWGNLINRTVSMAAKNFG
EVPDISGLELTDDDNALLDLAEKTFDIVADNIEHSRFRAGINEAMHVVGEANAYIAAQEP
WKLAKDEDQRDRLAVVLHTALQVVSDCNVLLTPYLPHAAQKVHETLGRTGEWAAMPRIDE
VTDDTPVELMGVGLPEEGRTYHVITGEYSHQQAAWKRIPIEAGTTLKKPKPIFAKLDPEL
AETGPEWAPVVH
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcacccatacttacgtctgtcgcctggccctatgccaatgggccccgccacatc
ggacacgtcgccggtttcggtgttccctccgacgtttttgcccgttaccagcgaatgcgt
gggcgcgacgtactcatggtctccggcactgatgagcacggaactccgctcttggttcag
gcggaaaaagaaggcgtcagtgtgcagcaacttgccgatacatacaacaagcaaatcgtt
gaagacctggccggacttggtctttcctatgacctctttaccaggacgacgacgcgcaac
cactacgccatcgtccaggagcttttcacgacgctgtactccaacggatacatggtgaag
caaacaaccctgggggcgattagcccgtcgacgggacgcacgcttccggaccgctacatc
gaaggcacctgcccgatctgcggcgcacccggcgcgcgcggcgatcagtgcgatacatgc
ggcaaccagctggaccccgccgacctgatcgactccgtctcaaagatcaatggcgaaaca
ccgaagttcgtggaaaccgagcactttttgctcgatctgcccgcactcgcggacgcgcta
ggggagtggctcgaatcccgccaagactggcggcccaacgtcctcaagttctccctgaac
atcttgaaggacatcaagccccgcgcgatgacacgcgacatcgactggggtgttcccgtc
cccctcgaaggatgggccgataacaagttcaagaagctctatgtgtggttcgacgccgtc
gtcggatacctgtctgcgtctatcgagtgggctcatcgcatcggggacccggacgcgtgg
aaaaagtggtggaccaaccctgaggccaagtcctactacttcatgggcaaggacaacatc
accttccactcccagatttggcccgctgaaatgctcggataccgcggtctcgggtcacgt
ggcggcacggaaggcaagttgggtgaccttcaattgccgacggaagtcgtgtcgtccgaa
tacctcaccatgtcgggctcgaagttctcgtcatccaagggcgtggtgatctacgtgcag
gatttccttcgcgaatttggccccgacccgttgcgctacttcattgctgtcgccgggccg
gaaaacaacgacacggacttcacctgggacgaattcgtccgacgtaacaacaacgagcta
gccaactcgtggggcaacttgattaaccgcacggtgtccatggcggcgaagaacttcggc
gaagtccccgatatttccgggcttgagctcactgacgacgataacgctctcctcgacctc
gcggagaaaaccttcgacatcgttgcggacaatatcgaacattcgcgtttccgcgccggg
attaacgaggccatgcatgtggtcggtgaggccaatgcctacatcgctgctcaggagccg
tggaaactggccaaggatgaggaccagcgtgaccgcctggccgtcgttttgcacacggcg
ctgcaggtcgtgtccgactgcaatgtgctgctcaccccgtatttgccacacgctgcgcag
aaggtacatgaaaccctggggcgcaccggcgagtgggcggccatgccgcgaatcgacgaa
gtgacggatgacaccccggttgagctcatgggggttggccttcccgaggaagggcggacc
taccacgtgatcaccggtgagtattcccaccagcaagcagcttggaaacgtatccccatc
gaagccggcacgacactgaagaagccgaagccgatcttcgcgaagctggaccccgagttg
gcggaaaccggcccggagtgggcgcccgtcgtccactaa

DBGET integrated database retrieval system