KEGG   Corynebacterium kroppenstedtii: ckrop_0622Help
Entry
ckrop_0622        CDS       T00896                                 

Gene name
chlI1
Definition
(GenBank) magnesium-chelatase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
ckp00860  Porphyrin and chlorophyll metabolism
ckp01100  Metabolic pathways
ckp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ckrop_0622 (chlI1)
Enzymes [BR:ckp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ckrop_0622 (chlI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 Sigma54_activat MCM AAA_30 AAA AAA_22 DUF815 AAA_32 CbiA AAA_16
Motif
Other DBs
NCBI-ProteinID: ACR17385
UniProt: C4LHT0
Position
complement(730069..731004)
Genome map
AA seq 311 aa AA seqDB search
MNRVYPFTHIHGQDELKEALILCAINPGIGGVLAFGDRGTGKTTTVRALGQLLSQHGEGS
SGHTPVIDVPLGVTEDRLIGSLDIDAALTTGEARFRPGLLADANNGFLYIDEINLLDDHL
VDVLLDVAASGVNIVERDGISHTHPARFVLVGSGNPEEGDLRPQLQDRFGLALRVDTLTD
PTERMTIVRERLAFDADPEAFLDDAQEEEQELATSIEQARDRVRDIELSEDAVLTAVEVC
TETGCVGHRGELVITRAARARAALHGNDTVAREDVGAVALAALRHRVPTEAFEAPGDVDA
RLTRTIHQVCE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcgtctatccgtttacacacatccacggacaagatgagctcaaagaagcactg
atcctctgcgccatcaatcccggtatcggcggcgtgctcgctttcggagaccgaggaaca
gggaaaacgacgacggtccgcgcattagggcaattgctgtcacaacatggtgaaggttcg
tccggacacacaccggttatcgacgtccccctcggcgtgactgaagaccgcctgatcgga
tcgctcgatatcgacgccgcactcaccactggcgaggcgcggttccgcccgggattattg
gccgacgccaacaatgggttcctctatatcgacgaaattaatctgctcgacgaccacttg
gtggatgtcttgctcgatgtcgcggcgtccggggtcaacattgtggagcgcgacggcatt
agtcacacgcacccggcgcgatttgtgctggtggggtcgggcaatcctgaagagggcgat
ttacggccacaattgcaggaccgattcggcctggccttgcgcgtggacactcttaccgac
ccgactgagcgtatgactattgttcgcgagcggcttgccttcgacgctgaccctgaggct
tttcttgatgacgcccaggaggaagagcaggagctagccacgtctattgagcaggcgcgt
gaccgcgtccgtgatattgagctcagtgaagatgccgtgctcactgcggttgaggtctgt
accgaaacgggatgcgtggggcatcgtggcgagctggttattacccgtgccgcacgtgcg
cgagctgcgctccacggtaacgacactgtggccagggaagatgttggcgcggtggctctc
gcggcgctccggcaccgcgtgccgaccgaggcattcgaagcgccgggtgatgttgatgcg
cggttaacgcgcacgattcatcaggtatgtgaataa

DBGET integrated database retrieval system