KEGG   Corynebacterium kroppenstedtii: ckrop_0623Help
Entry
ckrop_0623        CDS       T00896                                 

Gene name
chlH
Definition
magnesium-chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ckrop_0623 (chlH)
Enzymes [BR:ckp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ckrop_0623 (chlH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(731025..734795)
Genome map
AA seq 1256 aa AA seqDB search
MRILFLGFGGSIALTMHSAWDEFREKFAADTASPDDESAGAVDLRHRPFDAGTLATADDL
DAELAAADAVFLQGPMTPEDIDALGAALDTAIEEAHKSGRAFVVSASVPCADPIVDRATS
PRPGITASLREALRQLTPGGMCHAIRLVQTVLAGAPDPGSLAQSRPHGIISLDDDDLLRA
CGYAVRAADGETPTGGETSADGDDRPHIVHAPEGVRIGIAASPFQVASHDTLAASYIAKL
VEASGATAIVWAGDPTDVPDGVEPPPAVDAWMNLTGFTLAGTHANPRVDNGVEFLTETGV
PMITPVPLLRMALDRWQTSDLPGLTAGQVSMNIAIPEFESGLAPWVIGGRGIPAVETDDP
DHAADPRLAVERMLPDPYMCALVVNRTIRTVALRRLPAEQRKLSITIFGHDADGTIGTAA
HLDVFRSLWNFLHHLRAEGYTVDIPQTPEALVDSLFDSDAGNRSTCHVAATWPATEYNEA
LTSSQVSRIDRLWTRTPGMIDTDGRELFVRGVRLGNVFIGVQPDFGDVADPLNVLMAPEA
SPSHSFAAYYLWLEHEFSHDVMLHWGTHGALEFMPGRSTGLTRDDWPLLLTGSVPHSYLY
AMSNPAEGTIAKRRSFAGLVSYLTPQLIDAGLHGALAAAAEEAFRLLTSAKDGSVELNAD
TYSELVTLAAEADLTDCPPPNSADAGKVEHGEDDGSHNPWHEWVSHVSAIAERIRRTPIP
EGLHTLGEPLSQDKTARILSLACTYPLATSDPLADHLDEEHITEAVDAVVNDDFARFTSL
VAGAFDNDAKTTSDAKTANGSEPANATPASWFRHLRRLHSQLTSSKETDGLLAALSGAYI
PPAPGGEPASRPESLPTGRNTHGADPATMPTPTAARRGAATADALVEQLRQEEGHYPESI
AMVIWGMDNVKTNGEGIAQAFHLIGAEPLTDERGRVSRFRIVPLDELGRPRVDVVCTMSG
VGRDLLAGPMELLDDAIHAIASLPEEPEDNPVRAHAMQQAEELGLDLDSAANRIYATAPG
NYGTGVNKLVQSSEWDDNSDLAEVYLHRMGHAWGKHVKGKENRALLESSLSRVSATFQNV
DSTEISLAGVDHYFEFLGGVSSVVETVSGARPSAKVSHAWQHETNVESLDDAMRLESRTR
LLNPAWYEAQLRHGYQGVANIRSRFENTFGMQATARVVDNWVFDRTASTFITDDDMRDRL
AEHNPAAVLSMTERLLEAADRGLWEADDDVLDQLEDISDSLDATVEGVTPMSSARH
NT seq 3771 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattctttttctcggattcggtgggtccattgcgctcactatgcactccgcatgg
gacgaattccgcgaaaagtttgctgcagacaccgcgagccctgacgacgagagcgctggg
gctgttgatttacgtcaccggcctttcgatgccgggacgctggcaaccgcggacgatctt
gatgcagaactggctgctgccgatgctgtgttcctgcaaggtccgatgacaccggaggat
atcgacgctctgggggcggcccttgatacggccatcgaggaagcgcacaagtctgggcgt
gcattcgtggtctccgcatccgtgccttgtgccgaccccattgttgaccgggcaacctca
ccacggccaggaatcacagcgagtctgcgggaagcgctccggcaactcacgcccggtgga
atgtgccacgccatccgtctggtccaaacagtcttagccggggctcccgatcccggttct
ctcgcacagtctcgcccgcacggcatcatttctcttgacgacgatgacctcttgcgggcc
tgcggatatgccgtgagggcggccgatggggaaactccgaccggtggggaaacttcggcc
gatggagatgaccgcccccacatcgttcacgctcctgaaggcgtacgcattgggattgcc
gccagccctttccaggttgccagccacgacaccctcgcggcctcatatatcgcgaaactc
gttgaggccagtggcgctacagccatcgtgtgggcaggagatcccaccgacgtgcccgat
ggcgtcgaacctccaccggccgtggacgcgtggatgaacctcaccggtttcacgcttgcg
ggaacgcacgcgaatccccgtgtcgataatggcgtcgaattcctcacggagacaggcgtt
cccatgatcaccccggtccccctcttgcggatggccttggaccggtggcaaacgtctgat
ctgcctggcctgacagcagggcaggtatcaatgaatatcgctattcctgaattcgaatca
gggctagcgccgtgggtaatcggtgggcgcggcatcccggccgttgaaaccgacgacccc
gatcacgctgcagacccacgcctcgccgtcgagcgaatgctccccgacccctacatgtgc
gcactcgtggtgaaccgcaccatcagaaccgtggcacttcgccgcctgcccgcggaacaa
cgaaaactctccatcaccatttttggccacgacgccgacgggacaatcggtaccgccgcg
cacctggatgtattccgctcgctgtggaacttcctccaccacctccgcgcggagggctat
accgtcgacatcccccaaactccggaggccctcgtcgatagcctttttgattccgacgcg
ggtaaccgcagcacgtgtcatgtcgcagcaacatggcccgccaccgagtacaacgaggcg
ttaacgtcgtcgcaggtcagccggatcgaccgactatggacgcgaaccccgggaatgatc
gacacagacggccgcgaactcttcgtccgcggcgtgcgccttggcaatgtgttcatcggc
gtccaaccggattttggcgatgttgccgaccccctcaacgtcctcatggcgcccgaggcc
tccccctcgcattctttcgccgcctattacctctggctcgaacacgaattcagccacgac
gtcatgctccactggggtacccatggggctctggaattcatgcccgggcgttcaaccggg
ctgaccagggacgactggccgctgctcctcaccggcagcgtcccgcactcgtatttgtac
gcgatgagcaaccccgctgagggcacgatcgcgaaacgtcgatccttcgccggtttggtc
agctacctcactcctcaacttatcgacgctggcctccatggtgccctggccgctgccgcc
gaggaagcgttccggctgttgacgtcggcaaaggatggctcggtggagctgaatgctgac
acctattctgaattggtgacgctggccgccgaagctgatctgaccgactgtcccccgcct
aacagcgccgatgcgggaaaggtggaacacggcgaagacgacggttcgcataacccctgg
cacgaatgggtcagtcacgtttccgctatcgcagagcgaatccgccgtacccctattcca
gaaggtctccacacactcggcgaacctctcagccaggacaaaaccgcgcggatactgagc
ctcgcctgcacttatccgttggcgacgtccgatccacttgctgatcacctggacgaagaa
cacatcacggaggccgtcgacgctgtcgtcaatgatgatttcgcgcgattcacttcgctc
gtggcgggcgcattcgataatgacgcgaagaccacaagcgacgcgaagaccgcaaacggc
tcagagcccgcaaacgcaaccccagcgtcgtggttccgacacctccgtcggctccactcc
cagttaacgtcctcgaaggaaaccgatggcctcctcgctgcgctatccggggcgtacatc
ccacccgcgcccggcggagaacccgcgtcacgccccgaatcgctccccaccggccggaac
acacatggcgccgacccagccaccatgcccacccccaccgcggcccggcgcggcgccgcc
accgccgacgcactcgtcgaacaattacggcaggaagaaggccactaccccgaatctatc
gccatggtgatctggggaatggacaacgtcaaaaccaatggcgagggcatcgcgcaagca
tttcacctgatcggggcagagcctctcaccgatgaacggggacgcgtgagccgattccgg
atcgttcccctcgatgagctgggccgcccccgcgtcgacgtcgtctgcaccatgtcgggc
gtcggtcgcgaccttcttgcgggccccatggaactgcttgacgacgctatccacgcgatc
gcgtcgctacccgaagaaccagaggacaaccccgtccgcgcccacgccatgcaacaggcg
gaagagcttggcctggacctggattcggccgcgaaccgcatttatgcgaccgcgccgggc
aattatgggaccggcgtcaacaagctcgtgcagtcgtcggagtgggatgacaattccgat
ttggccgaggtgtatctgcatcgcatgggtcacgcgtggggcaagcacgttaagggcaaa
gagaaccgggccctcctcgagtccagtttgtctcgcgtttccgccacattccagaatgtg
gattcgacggagatttcattggccggcgtcgaccattatttcgagttcctgggcggggtg
tccagcgtcgtcgagacggtttcgggtgcgcgcccgtccgcgaaggtttctcacgcgtgg
cagcatgagaccaatgttgagtctctggatgatgcgatgaggttggagtcgcggacgcgt
ctgctcaatcccgcctggtatgaggcacagctcaggcacggttatcagggtgtggcgaac
atccggtcccgttttgagaacacgttcggtatgcaggctacggcccgcgtcgtcgataat
tgggtttttgaccgaactgcgtccacatttattaccgacgatgacatgcgcgatcggtta
gccgagcacaatcctgcggccgttctctcaatgacggagcgtctgcttgaggccgcggac
cgtggtctgtgggaggcggacgatgatgtgcttgaccagttggaagatatttcagatagc
ctggatgcgaccgtcgaaggtgttactccgatgtcttccgcccggcactaa

DBGET integrated database retrieval system