KEGG   Corynebacterium kroppenstedtii: ckrop_0635Help
Entry
ckrop_0635        CDS       T00896                                 

Gene name
folP1
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ckp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
747686..748498
Genome map
AA seq 270 aa AA seqDB search
MAIVNRTPDSFYDKGATFTDDAALAWVRSCVDAGAEIIDIGGVKAGRGDPVSIAEEIDRV
VPFVSAVREEFPSVHISVDTYRAPVGEAAITAGADLINDTWAGADPELVEVAGHYHRGYV
CSHTGGMEPRTLPRRVHYDDLVGDVIRSTTQRAKHAVNCGVPEDKVLIDPTHDFGKNTFH
SLALVRHARDLVSTGWPVLMALSNKDFVGETVGRPVDQRLAGTLAATALAAAQGVSVFRV
HEVAENLDACRMALAVQGVIPPYATTRGVE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgttaatcgcactcccgactctttttatgacaagggagcaacgtttaccgac
gacgcagccctggcgtgggttagaagctgtgtcgacgccggcgcggagatcattgatatc
ggtggtgtcaaagcgggccggggtgatcctgtctcgatcgctgaggagatcgatagggtg
gtgcccttcgtttctgctgtgcgtgaggaatttccctcggttcacatcagtgtggatacc
tatcgtgccccggtcggggaggctgcaattaccgctggtgcggatctgattaacgatacg
tgggcaggcgcagaccccgagctcgtcgaagtcgctggccattatcaccggggctatgtg
tgttcgcacacgggagggatggagccgcgcacgttgccacgccgtgttcattatgacgac
ctagtcggggacgttatccgctccacgacacaacgcgcgaaacacgcggtgaactgcggc
gttcccgaggacaaagtcctcatcgacccgacccacgacttcgggaagaacactttccac
agtttggcgttggtacgtcatgctcgcgatctcgtgtcgacggggtggccggtgctcatg
gccctatcgaataaggacttcgtgggagaaactgtcgggcgtccggtggaccagcgattg
gcaggtactctggcggcaaccgccctggcagcagcgcagggtgtgtccgtatttcgtgtt
cacgaagtggccgaaaacctggatgcgtgccgcatggcattggccgtgcagggcgttatt
ccgccgtatgcgacgactcgcggtgtggagtga

DBGET integrated database retrieval system