KEGG   Corynebacterium kroppenstedtii: ckrop_0694Help
Entry
ckrop_0694        CDS       T00896                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ckrop_0694 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ckrop_0694 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ckrop_0694 (thrC)
Enzymes [BR:ckp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ckrop_0694 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
816487..817935
Genome map
AA seq 482 aa AA seqDB search
MKYISTRDPHQSPVAFSDILLRGLAPDGGLYVPESYPQWSSSDLSRFRSFLNDQGYPALA
AEIISYFIDDIPRDDIEQMTQRAYRVPRFADPDIVPVSELEDGLFIGHLSEGPTAAFKDM
AMQLLGELFEYELSRRSTTLNIVGATSGDTGSSAEYAMRGRRGIRVFMLTPRGRMTPFQQ
AQMFSLDDPNIFNIALDGVFDDCQDVVKEISSDADFKAEFHIGAVNSINWARLMAQVVYY
VACWIRATETDESKVSFCVPTGNFGDICAGHIARSMGLPIDQLIVATNENDVLDEFFRTG
SYRVRSARETLATSSPSMDISRASNFERFIFDVLGRDVARTADLFGKRVREGGFDLSDDP
AFPSVAEKFGFRSGKSTHADRLATIKRVHDTYGVDIDPHTADGVTVAWQQREAVHTPIVC
LETALPVKFADTMREALGEEPETPERFTDIMQGGRHVADLPNDANAVKDFIRESIADSDV
TS
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatacatctccacccgtgatccgcaccagtcgcctgtggcgttttccgatattctg
ctccgcgggcttgcacccgatgggggcctgtatgtccccgagtcctacccgcaatggagt
tcatccgatttatcccggttccggtcatttcttaatgaccagggatatccagccttagct
gcggaaattatttcctattttatcgacgatattccgcgcgatgatattgagcagatgact
cagcgggcttaccgcgttcctcggttcgcggacccggatattgtgccggtcagtgagctg
gaggatggcctgttcatcgggcatttgtctgaaggccctaccgccgcgtttaaagacatg
gcgatgcagcttttgggtgagctgtttgaatatgaattatcacgacgctctaccactctg
aatattgtgggtgcgacttcgggggatacgggttcgtcggcggaatatgcgatgcgtggc
cgtcgtggaattcgtgtgtttatgttgactccgcgcggacgaatgacaccattccagcaa
gcgcagatgtttagcttggatgatcccaacatctttaatattgctttggacggtgtattc
gacgattgccaggatgtggtgaaagaaatttcatcagatgctgatttcaaggccgaattc
catatcggagccgtcaattcgattaactgggccaggctcatggcgcaggttgtctactat
gtggcctgttggattcgtgccacagaaacggacgagagcaaagtcagcttctgcgtgccc
acaggcaattttggggacatctgcgccggacatatcgcgcggagcatggggctgcccatc
gatcaactcatcgtcgcaacaaatgagaacgatgttttagacgagttcttccgcacgggt
agttaccgcgtgagatccgcgcgcgagaccttagcgacgtcgagcccttcgatggatatt
tctcgtgcgtccaacttcgagcgctttattttcgacgttctgggacgcgacgttgcccgc
accgcggacctgttcggaaagagagtccgtgagggcggttttgatctttcagatgacccg
gctttcccttcggtggcagagaaatttggtttccgctccgggaagtcgacccatgctgat
cgcttagcgacgatcaaacgcgtgcacgatacgtatggcgtcgatattgacccgcacacc
gctgatggcgtgaccgtggcgtggcagcagcgagaggcggtgcacacgccgatcgtctgc
ctggagacagcgctgccggtgaagtttgccgacacaatgcgggaggccttaggcgaggaa
ccggaaacgccagagcgctttactgacatcatgcagggtggccggcatgtggctgatctg
ccgaatgacgctaacgcggtgaaggacttcattcgcgagtccatagccgactctgatgtg
acgagctag

DBGET integrated database retrieval system