KEGG   Corynebacterium kroppenstedtii: ckrop_0700Help
Entry
ckrop_0700        CDS       T00896                                 

Gene name
aceF
Definition
(RefSeq) dihydrolipoamide acetyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ckrop_0700 (aceF)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ckrop_0700 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    ckrop_0700 (aceF)
Enzymes [BR:ckp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ckrop_0700 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(823100..825298)
Genome map
AA seq 732 aa AA seqDB search
MAFSVEMPELGESVTEGTVTTWLKQVGDTVAVDEPLLEVSTDKVDTEIPSPVAGVLTKII
ADEDDTVEVGEVIAEIGEEGDDTSSDDSGASEPSDSGSGDSGAEEKSSSEGEKSQKSSDS
GSSGSGPGEATDVEMPELGESVTEGTITQWLKSVGDEVEVDEPLLEVSTDKVDTEIPSPV
AGTLVEVLAEEDDTVDVGSVIARIGDANAASSSSDDSSDDKAESTEAEEESPAEDDEQAN
ASSSEDKGANGSGSGEATDVEMPELGESVTEGTITQWLKSVGDEVEVDEPLLEVSTDKVD
TEIPSPIAGTLVEVLAEEDDTVDVGSVIARIGDANAASSSSDDEADKKAEETKSEEKSEP
EPSKSEKAEETKDTSDSATSSETASPKASSASAPDREEPATRPSTKVNTGGKLPYVTPLV
RKLAEKHSVDLTTVEGSGVGGRIRKQDVLAAAEKAKAAPDTSSTSGNADEKPAQDGPRAA
WSTKRVDPKKAELIGTTQKVNRIRSLTASKTLESLHSSAQLTQVHEVDMTDVAALRKASK
PAFKEKYGVNLTYLPFFAKAVVEALISHPNVNASYNAETKEMTYHDKVNLGIAVDTEAGL
LSPVIHNAQDMTLPELAAAIADIADRARTNKLKPNDLTGGTFTITNIGSEGALTDTPILV
PPQAAMMGTGAIVKRPSVVPTSDGSDAIAIRQMVLLPLTYDHQIVDGADAGRFMTTVRDR
LETANFESDLDL
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctctgttgagatgcccgaactcggcgaatccgtcaccgaaggcacggtcacc
acgtggctcaaacaagtaggtgacaccgtcgctgtcgacgaaccacttctggaggtttcg
accgacaaggtcgacaccgagattccttcacccgttgctggtgtgttgacaaaaattatt
gccgacgaagacgacacggtcgaggtcggcgaggtcatcgcagagatcggtgaagagggc
gacgacaccagcagcgacgacagtggcgcatcggagccgtccgattctggctctggtgat
tccggcgctgaggaaaagagctcttcggagggcgagaagtcgcagaagtcctctgattct
ggttcgagcggttctggcccgggcgaggccaccgacgttgagatgccagagctcggcgag
tccgtgaccgagggaaccattacccagtggctcaagagcgtcggcgacgaagtcgaagta
gacgaaccgctgttggaggtctccaccgacaaggtcgacaccgagatcccctcccctgta
gccggtaccctcgtcgaagtgctcgctgaggaagatgacaccgtcgacgttggatccgtc
atcgcccgcatcggcgacgccaacgcggcatccagttcctccgacgacagctccgatgac
aaggctgagtccacggaagctgaagaggaaagccccgccgaggacgacgagcaggcgaac
gcaagctcgtctgaggacaaaggggcaaacggttctggttcgggcgaagccaccgacgtt
gaaatgcccgagctcggcgagtctgtcacagagggaactattacccagtggcttaagagt
gtcggcgacgaagtcgaggtcgacgaaccgctgttggaggtctccaccgacaaagtcgac
accgaaatcccctcccctattgccggtaccctcgtcgaagtccttgccgaggaagacgac
accgtcgacgtcggatccgtcattgcccgcatcggcgacgccaacgcagcatccagcagc
tctgacgacgaggccgacaagaaggctgaggaaaccaagtctgaggagaagtccgagcct
gagccctctaagagcgagaaggctgaggagaccaaggacacctcggactccgccaccagc
tccgaaacggcatcgcccaaggcatcgtccgccagcgcacccgatcgggaggaacccgct
actcgcccatcgaccaaggtcaacaccggtggcaagctcccgtacgtgaccccgctggta
cgaaagctggcggagaagcacagcgttgatctcaccacagttgagggctccggagtcggt
gggcgaatccgcaagcaggacgttcttgccgccgccgagaaagcgaaggccgcgccggac
acgtcgtcgacaagcggaaatgcagacgagaagccggcacaggacggtccgcgtgcagcg
tggtccaccaagcgcgtcgatccgaagaaggcagagctgatcggcacgacccaaaaggtc
aaccgtattcgctcgctgaccgcatcgaagacgctggaatccctccactcgtccgcgcag
ctaacgcaggttcacgaggtcgatatgaccgacgtcgctgcactgcgcaaggcgtcgaag
ccagcgttcaaggagaagtacggcgtcaacctcacctacctccccttcttcgcaaaggcc
gttgtcgaagcgctcatttcccacccgaatgtcaacgcgtcctacaacgctgagaccaag
gaaatgacctaccacgacaaggtcaacctggggatcgccgtcgatacggaagctggcctg
ctctcaccggtcattcacaacgctcaggacatgacgttgccggaactggctgcagcaatc
gctgacatcgccgaccgggcacggaccaacaagctgaagccgaacgacctcaccggcggc
accttcaccatcaccaacattggttcagaaggcgcactgactgacaccccgatcctggta
ccgccacaggcagccatgatggggaccggcgcgatcgtaaagcggccgtccgtcgtcccg
acatccgacggttctgacgcgattgccatccgccagatggtgctgctgcctctcacctac
gatcaccagatcgtcgacggtgcagacgcagggcggttcatgaccaccgtccgcgatcgc
ctcgagacagctaatttcgagagtgatcttgacctctaa

DBGET integrated database retrieval system