KEGG   Corynebacterium kroppenstedtii: ckrop_0700Help
Entry
ckrop_0700        CDS       T00896                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
ckp00020  Citrate cycle (TCA cycle)
ckp00310  Lysine degradation
ckp01100  Metabolic pathways
ckp01110  Biosynthesis of secondary metabolites
ckp01120  Microbial metabolism in diverse environments
ckp01130  Biosynthesis of antibiotics
ckp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ckrop_0700 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ckrop_0700 (sucB)
Enzymes [BR:ckp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ckrop_0700 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2254 Spt20 CobT
Motif
Other DBs
NCBI-ProteinID: ACR17461
UniProt: C4LI06
Position
complement(823100..825298)
Genome map
AA seq 732 aa AA seqDB search
MAFSVEMPELGESVTEGTVTTWLKQVGDTVAVDEPLLEVSTDKVDTEIPSPVAGVLTKII
ADEDDTVEVGEVIAEIGEEGDDTSSDDSGASEPSDSGSGDSGAEEKSSSEGEKSQKSSDS
GSSGSGPGEATDVEMPELGESVTEGTITQWLKSVGDEVEVDEPLLEVSTDKVDTEIPSPV
AGTLVEVLAEEDDTVDVGSVIARIGDANAASSSSDDSSDDKAESTEAEEESPAEDDEQAN
ASSSEDKGANGSGSGEATDVEMPELGESVTEGTITQWLKSVGDEVEVDEPLLEVSTDKVD
TEIPSPIAGTLVEVLAEEDDTVDVGSVIARIGDANAASSSSDDEADKKAEETKSEEKSEP
EPSKSEKAEETKDTSDSATSSETASPKASSASAPDREEPATRPSTKVNTGGKLPYVTPLV
RKLAEKHSVDLTTVEGSGVGGRIRKQDVLAAAEKAKAAPDTSSTSGNADEKPAQDGPRAA
WSTKRVDPKKAELIGTTQKVNRIRSLTASKTLESLHSSAQLTQVHEVDMTDVAALRKASK
PAFKEKYGVNLTYLPFFAKAVVEALISHPNVNASYNAETKEMTYHDKVNLGIAVDTEAGL
LSPVIHNAQDMTLPELAAAIADIADRARTNKLKPNDLTGGTFTITNIGSEGALTDTPILV
PPQAAMMGTGAIVKRPSVVPTSDGSDAIAIRQMVLLPLTYDHQIVDGADAGRFMTTVRDR
LETANFESDLDL
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctctgttgagatgcccgaactcggcgaatccgtcaccgaaggcacggtcacc
acgtggctcaaacaagtaggtgacaccgtcgctgtcgacgaaccacttctggaggtttcg
accgacaaggtcgacaccgagattccttcacccgttgctggtgtgttgacaaaaattatt
gccgacgaagacgacacggtcgaggtcggcgaggtcatcgcagagatcggtgaagagggc
gacgacaccagcagcgacgacagtggcgcatcggagccgtccgattctggctctggtgat
tccggcgctgaggaaaagagctcttcggagggcgagaagtcgcagaagtcctctgattct
ggttcgagcggttctggcccgggcgaggccaccgacgttgagatgccagagctcggcgag
tccgtgaccgagggaaccattacccagtggctcaagagcgtcggcgacgaagtcgaagta
gacgaaccgctgttggaggtctccaccgacaaggtcgacaccgagatcccctcccctgta
gccggtaccctcgtcgaagtgctcgctgaggaagatgacaccgtcgacgttggatccgtc
atcgcccgcatcggcgacgccaacgcggcatccagttcctccgacgacagctccgatgac
aaggctgagtccacggaagctgaagaggaaagccccgccgaggacgacgagcaggcgaac
gcaagctcgtctgaggacaaaggggcaaacggttctggttcgggcgaagccaccgacgtt
gaaatgcccgagctcggcgagtctgtcacagagggaactattacccagtggcttaagagt
gtcggcgacgaagtcgaggtcgacgaaccgctgttggaggtctccaccgacaaagtcgac
accgaaatcccctcccctattgccggtaccctcgtcgaagtccttgccgaggaagacgac
accgtcgacgtcggatccgtcattgcccgcatcggcgacgccaacgcagcatccagcagc
tctgacgacgaggccgacaagaaggctgaggaaaccaagtctgaggagaagtccgagcct
gagccctctaagagcgagaaggctgaggagaccaaggacacctcggactccgccaccagc
tccgaaacggcatcgcccaaggcatcgtccgccagcgcacccgatcgggaggaacccgct
actcgcccatcgaccaaggtcaacaccggtggcaagctcccgtacgtgaccccgctggta
cgaaagctggcggagaagcacagcgttgatctcaccacagttgagggctccggagtcggt
gggcgaatccgcaagcaggacgttcttgccgccgccgagaaagcgaaggccgcgccggac
acgtcgtcgacaagcggaaatgcagacgagaagccggcacaggacggtccgcgtgcagcg
tggtccaccaagcgcgtcgatccgaagaaggcagagctgatcggcacgacccaaaaggtc
aaccgtattcgctcgctgaccgcatcgaagacgctggaatccctccactcgtccgcgcag
ctaacgcaggttcacgaggtcgatatgaccgacgtcgctgcactgcgcaaggcgtcgaag
ccagcgttcaaggagaagtacggcgtcaacctcacctacctccccttcttcgcaaaggcc
gttgtcgaagcgctcatttcccacccgaatgtcaacgcgtcctacaacgctgagaccaag
gaaatgacctaccacgacaaggtcaacctggggatcgccgtcgatacggaagctggcctg
ctctcaccggtcattcacaacgctcaggacatgacgttgccggaactggctgcagcaatc
gctgacatcgccgaccgggcacggaccaacaagctgaagccgaacgacctcaccggcggc
accttcaccatcaccaacattggttcagaaggcgcactgactgacaccccgatcctggta
ccgccacaggcagccatgatggggaccggcgcgatcgtaaagcggccgtccgtcgtcccg
acatccgacggttctgacgcgattgccatccgccagatggtgctgctgcctctcacctac
gatcaccagatcgtcgacggtgcagacgcagggcggttcatgaccaccgtccgcgatcgc
ctcgagacagctaatttcgagagtgatcttgacctctaa

DBGET integrated database retrieval system