KEGG   Corynebacterium kroppenstedtii: ckrop_0707Help
Entry
ckrop_0707        CDS       T00896                                 

Definition
glutamine amidotransferase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ckrop_0707
Enzymes [BR:ckp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ckrop_0707
Peptidases [BR:ckp01002]
 Cysteine Peptidases
  Family C44
   ckrop_0707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(830855..832792)
Genome map
AA seq 645 aa AA seqDB search
MCGLLGLIAASGNAEDFVQATGSSLTCMRHRGPDEDGTWNDADVVYGFNRLSIIDLAHSH
QPLQWGPENQPNRYALTFNGEIYNYKELRSELKDKGYTFATDGDSETIVVGYRHWGRDVV
HHLRGMFAFAVWDSVDKTMYLARDQFGIKPLYWATTDKGTLFASEKKCLLSMADKADIDL
SLDKRAIEHYMDLQYVPEPESLHTGICRLESGCCATVKPGEKPKVHRWFTPRFPETSVNK
ENIDSEISKIEHALEDSVAKHMRADVTVGSFLSGGIDSTAIAALAKRHNPNLLTFTTGFE
REGYSEVDVAAESAEAIGVEHIVKVVSPEEFAEVLPRIIWYLDDPVADPALVPLYFVAAE
ARKHVKVVLSGEGADELFGGYNIYHEPLSLAPFEKIPSFAKKGLRTLAQRLPDGVRGKSL
LERGTTPLEERYYGNARSFSFDQLRRVIPWAKKEWNHTDVTTPIYEKSQGWDPVARMQHL
DLFTWLRGDILVKADKMTMANSLELRVPFLDKEVFNVAQSLPTSMKLAHGTSKWALRQAM
ERIVPPHVLNRRKLGFPVPIRHWLAGDELYGWAEDIITSSQAGEIVDLGATRSMLEEHRS
SMTSGSGPDHSRRLWTVLAFLIWYGIFVDKSITPDIPEPTYPVEM
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtttgctcggactcatcgccgctagcggaaatgcggaggattttgttcaagcc
actggttcatcactgacctgcatgcgtcaccgtggcccggatgaggatggcacctggaat
gacgccgacgtggtctacggattcaatcggctgtccatcattgacctcgcacattcccat
cagcctttacagtggggcccggaaaaccagcccaaccggtacgcgctgactttcaacggg
gaaatctacaactacaaagagctgcgctccgaactgaaggacaagggatacaccttcgcc
accgacggcgacagcgaaacgatcgtcgtcggctaccgccactggggacgcgacgtcgtt
caccatcttcgtggaatgtttgcgttcgccgtgtgggactcggtggacaaaacgatgtac
ctagcacgggaccagttcggcattaaacccctctactgggcaactaccgacaagggcaca
ctctttgcttcagagaagaaatgcctgctctccatggcagacaaagctgacatcgatctg
tcgctggacaagcgcgcaatcgagcattacatggacttgcagtatgtgcccgaaccagag
tccctgcacaccgggatttgccggctggagtccggttgctgcgcgacagtgaagcccggt
gaaaagcccaaggtacatcgctggtttactccccgcttccccgagacttcggtgaacaaa
gagaatatcgattccgagatttcaaagatcgagcatgccctcgaggattccgttgctaag
cacatgcgtgccgacgtcaccgtcggatcgttcctgtctggcggaatcgactcgacggcc
attgcggcgctcgctaaacgccacaacccgaacttgctgaccttcaccacgggtttcgaa
cgcgaggggtattcggaagtcgacgttgccgcggaatccgcggaagcgatcggggtcgag
cacatcgtgaaggtggtctcccccgaggaattcgccgaggtactcccccgcatcatctgg
tatttggacgatccggtggcagaccctgccctcgtccccctgtatttcgtcgcggcggaa
gccaggaagcacgtcaaagttgtcctctctggcgagggcgccgacgagctcttcggcgga
tacaacatctaccatgagccgctttctcttgctccgtttgagaagatcccgtcgtttgcc
aagaagggtctgcggaccctcgcacaacgcctccccgatggggtgcgaggcaagtcattg
ttagagcgaggtaccacgcctcttgaagagcggtactacggtaacgcccggtccttctcc
ttcgaccagcttcgtcgcgtgattccgtgggccaagaaagagtggaaccacacggatgtc
acgactccgatttacgaaaagtcgcagggctgggatccggtagccaggatgcagcacctg
gacttgttcacgtggttgcgtggcgacattctggtcaaggctgacaagatgaccatggcg
aattccctcgagctccgtgtgccgttcctcgacaaagaggtcttcaatgtcgcgcaatca
ttgccgacgagcatgaagctggctcatggcacatcgaagtgggcattgcgccaggcgatg
gaacgcatcgttcctccgcacgttcttaaccggcggaagcttgggttccctgttccgatc
cggcactggttggccggcgacgagctctacggctgggcagaggacatcatcacctcatcg
caggccggtgaaatcgtcgacctcggagccacccgctccatgctggaagaacaccgctct
tccatgaccagtggatctggccctgaccattcccgccgcctatggactgtgttggcattc
ttaatctggtacggaatcttcgtggataagtcgatcaccccggacatcccagagccgacg
tacccggtcgagatgtaa

DBGET integrated database retrieval system