KEGG   Corynebacterium kroppenstedtii: ckrop_0719Help
Entry
ckrop_0719        CDS       T00896                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:ckp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ckp00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ckp00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ckp00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ckp00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ckp00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
846681..847661
Genome map
AA seq 326 aa AA seqDB search
MSDHASVRPLTVGFDIGGTNLRGAVVTDEGTIIDSEQIPTPASSHALEDGVVQIVRHLQR
RHHIAAVGMAVAGFLTPDCRTVRYAPHLPWRDAKVVDRLEERLRLPVRLEHDANSAAWGE
YRYGSAYDENNWVLFAIGTGIGGTLMVNGEIYRGAYGTAPEFGHICVVPDGRQCSCGKRG
CLERYCSGTAMATTAREMIGSHTDLDSDLLRDYRTRPDEITGRHVSLAAREGDPLAKLVV
DDFGLWLGRGLAMVQDFFDPSLIVIGGGVSTDSALFMSRALRAYADNVVGAGHRPLAEIK
TATLGAEAGMIGVADLARDSFKESHA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcacgcttctgtccggccgcttactgtcggctttgatattggtggtacgaac
ctgcgtggtgcggttgttaccgacgaggggacaatcatcgattcggagcaaatcccgact
ccggcttcatcacatgcgctggaagacggtgtggtgcagattgtccgacacttacaacgc
cggcaccacatcgctgcggtagggatggcagtcgccggattcttgacgccggactgtcga
acagtccggtacgcaccccaccttccctggcgcgatgcgaaggtggtcgaccgtctggag
gagcggcttcgtcttcccgtccgcttggagcacgacgctaattctgccgcgtggggcgag
tatcgctacggcagcgcctatgacgagaacaattgggtgctctttgccatcggaaccggt
attggcggtacgttgatggtgaacggcgagatctatcggggagcgtacggcaccgcgccc
gagttcggtcatatctgcgtagtccccgatggtcgtcaatgctcatgcggtaagcggggt
tgcctggaacgctactgttccgggacagcaatggcgacgaccgctcgcgaaatgatcggt
tcccatactgacttagactctgacctacttcgcgactaccggacccgcccggatgaaatc
accggccggcatgtctctctcgctgcccgagaaggggatcccctagcgaagctcgtggtc
gatgactttggcctgtggttgggccgaggtctggccatggtccaggactttttcgacccg
tccctgatcgtcatcgggggtggcgtttccaccgactctgctctttttatgtcccgtgct
cttcgggcttatgccgataatgtggtgggggcagggcatcggccactcgcggagatcaaa
acggcaacattaggggcagaagccggtatgattggggtcgctgatttggctcgagatagc
ttcaaggaaagtcatgcataa

DBGET integrated database retrieval system