KEGG   Corynebacterium kroppenstedtii: ckrop_0795Help
Entry
ckrop_0795        CDS       T00896                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ckrop_0795 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ckrop_0795 (trpC)
Enzymes [BR:ckp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ckrop_0795 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
936565..937380
Genome map
AA seq 271 aa AA seqDB search
MSSVLDTIVDGVLDDLATREARVSFADIKAQSHDMPAPRDAMSALSAPGVGVIAEVKRAS
PSKGSLARIPEPAELARQYEANGARVISCLTEERRFKGSLADLDAVRAAVDIPVLRKDFV
VTPYQIHEARVHGADLILLIVAALQQPQLESLLDRTESLGMTAIVEVHTEEEAERAIAAG
AKVVGVNARNLKTLDVDTSVFGTIAPGLPSDVIKVAESGVKDRNDLLAYAGAGADAVLVG
EGLVTAGNPGLACKSLVAAGIHPACPKNLAE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggttttagacactatcgtcgatggcgtcttagacgatcttgcaacccgtgaa
gctcgcgtcagttttgcggatatcaaagcacagtcgcatgacatgcccgcccctcgcgat
gccatgtccgcattgtctgctcccggtgtgggagtgatcgccgaagtcaaaagggcaagc
ccatccaagggaagcctggcgcggatccccgaaccggccgagctcgccaggcaatacgaa
gccaatggtgccagagtcatttcctgtctcaccgaagaacgacgcttcaaaggcagcttg
gctgacctggacgccgtacgagcagccgtcgacattccggtcctccgaaaagatttcgtc
gtcaccccctatcagatccacgaagcccgcgttcatggagcggacctcattctcctcatc
gtggcagcactgcagcagcctcagcttgaatcgcttctcgaccgcaccgagtctctcggg
atgactgccatcgttgaagttcacaccgaagaggaagcagagcgcgccatcgccgcaggc
gcaaaagtcgtgggagtcaacgcccgcaacctcaaaacactcgatgtcgatacctccgtg
tttggcactatcgcgccgggtttgccgtcggacgtgattaaggtcgctgaatcgggggtg
aaagatcgcaatgatttgctggcctatgctggtgccggtgcggatgcggtcttggtcggc
gaggggctggttactgcaggtaatcccggtttagcgtgtaagagtttggtcgctgcgggc
atccacccggcatgtccgaagaatctcgctgagtaa

DBGET integrated database retrieval system