KEGG   Corynebacterium kroppenstedtii: ckrop_0795Help
Entry
ckrop_0795        CDS       T00896                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
ckp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ckp01100  Metabolic pathways
ckp01110  Biosynthesis of secondary metabolites
ckp01130  Biosynthesis of antibiotics
ckp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ckrop_0795
Enzymes [BR:ckp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ckrop_0795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase
Motif
Other DBs
NCBI-ProteinID: ACR17551
UniProt: C4LI96
Position
936565..937380
Genome map
AA seq 271 aa AA seqDB search
MSSVLDTIVDGVLDDLATREARVSFADIKAQSHDMPAPRDAMSALSAPGVGVIAEVKRAS
PSKGSLARIPEPAELARQYEANGARVISCLTEERRFKGSLADLDAVRAAVDIPVLRKDFV
VTPYQIHEARVHGADLILLIVAALQQPQLESLLDRTESLGMTAIVEVHTEEEAERAIAAG
AKVVGVNARNLKTLDVDTSVFGTIAPGLPSDVIKVAESGVKDRNDLLAYAGAGADAVLVG
EGLVTAGNPGLACKSLVAAGIHPACPKNLAE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggttttagacactatcgtcgatggcgtcttagacgatcttgcaacccgtgaa
gctcgcgtcagttttgcggatatcaaagcacagtcgcatgacatgcccgcccctcgcgat
gccatgtccgcattgtctgctcccggtgtgggagtgatcgccgaagtcaaaagggcaagc
ccatccaagggaagcctggcgcggatccccgaaccggccgagctcgccaggcaatacgaa
gccaatggtgccagagtcatttcctgtctcaccgaagaacgacgcttcaaaggcagcttg
gctgacctggacgccgtacgagcagccgtcgacattccggtcctccgaaaagatttcgtc
gtcaccccctatcagatccacgaagcccgcgttcatggagcggacctcattctcctcatc
gtggcagcactgcagcagcctcagcttgaatcgcttctcgaccgcaccgagtctctcggg
atgactgccatcgttgaagttcacaccgaagaggaagcagagcgcgccatcgccgcaggc
gcaaaagtcgtgggagtcaacgcccgcaacctcaaaacactcgatgtcgatacctccgtg
tttggcactatcgcgccgggtttgccgtcggacgtgattaaggtcgctgaatcgggggtg
aaagatcgcaatgatttgctggcctatgctggtgccggtgcggatgcggtcttggtcggc
gaggggctggttactgcaggtaatcccggtttagcgtgtaagagtttggtcgctgcgggc
atccacccggcatgtccgaagaatctcgctgagtaa

DBGET integrated database retrieval system