KEGG   Corynebacterium kroppenstedtii: ckrop_0796Help
Entry
ckrop_0796        CDS       T00896                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ckrop_0796
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ckrop_0796
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ckrop_0796
Enzymes [BR:ckp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ckrop_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
937429..938727
Genome map
AA seq 432 aa AA seqDB search
MCVSNSESVHRNPYSDLPTIADVFAETTSTEPDDRGHWGEYGGRYIPEALMGVITEVTDA
WNKARTDPEYIEQLNDLHVHYSGRPSPLYYASRFSDASHARVYLKREDLNHTGSHKINNV
LGQVLLAQRMGKKRVIAETGAGQHGVATATACALLGLECHIYMGAVDARRQALNIARMRL
LGAEVTAVTIGSQTLKDAINEAMRFWVSHADDTYYCFGTAAGPHPFPQMVRDLQRIIGYE
AREQILHAEGRLPDAVVACVGGGSNAIGLFHRFIDDSSVQLIGAEAGGDGFETGRHAATI
TAGNEGVFQGSYAALMEDEDGQIVESHSISAGLDYPGVGPEHSYLHHVGRAEYLPITDAQ
AMDAFMLLCKTEGIIPAIESSHALAAARVYADRWDHDSDDGPLLIVNVSGRGDKDVDTAA
KWFDLKPKEELD
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcgtgagtaactcagaatcagttcatcgcaatccgtatagtgatctgcctactatc
gccgatgtgttcgcggagacgacatcgactgagcccgatgatcgtggccattggggtgag
tacggtggccggtatattccggaagccctgatgggggtcattaccgaagttaccgacgcg
tggaacaaggcgagaactgaccctgagtacattgagcagttgaatgacctgcatgtccat
tattcgggtcggccatcgccactgtattatgcttcgcgcttttccgatgctagccatgct
cgggtgtatttaaagcgggaggacttaaaccacaccgggtcccacaagattaataacgtc
ctgggccaggtgctgttggctcaacgcatgggtaaaaagcgcgtcatcgctgagacgggg
gccggccagcatggtgttgcaactgctacggcatgtgcattgctcggcttagagtgccac
atctacatgggggccgtggatgcgcggcgtcaggccctgaatatcgcgcgtatgcgttta
ctgggcgctgaggtcacagctgtcaccatcggttcccagactcttaaagatgccatcaac
gaggccatgcgtttttgggtatcacatgccgatgacacgtactactgctttggtactgca
gctggcccccatccgttcccgcagatggttcgtgatctccagcgaatcatcgggtatgaa
gcacgcgagcaaatcctgcacgcagaaggccgccttcccgacgccgtcgtcgcttgtgtt
ggtggtggctcgaacgcgatcgggcttttccaccgttttatcgacgattcctctgttcag
ctcatcggtgccgaagccggcggtgacggttttgagactggtcgccacgctgcgacgatt
accgcaggcaatgaaggtgtcttccagggctcatatgccgccctcatggaagatgaggat
ggccaaatcgtcgagtcccactccatttcggctgggctagattatccgggtgtagggccg
gagcactcgtatcttcatcatgtcgggcgcgctgagtaccttcccatcacggatgcacaa
gccatggatgcgttcatgctcttgtgcaagaccgaaggaattatccctgctattgagtct
tcgcatgctcttgcggcagcgcgagtctatgccgatcgctgggatcatgactcagatgac
ggcccacttctgatcgtcaacgtatcgggccgcggcgataaagatgtggacaccgccgcg
aagtggtttgaccttaaacccaaggaggagctggactaa

DBGET integrated database retrieval system