KEGG   Corynebacterium kroppenstedtii: ckrop_0797Help
Entry
ckrop_0797        CDS       T00896                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ckrop_0797
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ckrop_0797
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ckrop_0797
Enzymes [BR:ckp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ckrop_0797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
938727..939530
Genome map
AA seq 267 aa AA seqDB search
MAAFSSDSPAGALRDVFAQARGEQRAAFIGYLPSGYPTKHDSDELMACLASYADVIEVGI
PFSDPMMDGPVIQEAGMAALKAGFRVKDSLSSVRKITDAGGRSVVMSYWNPILQYGPEKY
AEELAESGGLGTIIPDLLPEESTRWAEACHEHGLAPIYLVAPSTSPERMALTVGAGDGFV
YAASHMGVTGAQESVNSGARDLVNRVREHTDLPVAVGLGVSNGQQAAEIAQYADGVIVGS
ALIRAAKDGLRSLEALAKELSEGVRGD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcggcattttcttctgattcccccgcaggggcgcttcgcgacgttttcgcacaggcc
cgcggcgagcaacgagctgcgttcatcggttatctgccatcggggtacccgacgaagcac
gactctgacgagttgatggcgtgcctggcgtcctatgcggacgtcatcgaggttggaatt
ccgttctctgaccccatgatggacggtcctgtcatccaggaagccggcatggctgcattg
aaagcaggttttcgcgtcaaagattcactcagctctgtccgtaagattaccgacgccggt
ggtcgaagcgtcgtcatgagctactggaacccgatcttgcagtatggcccggaaaaatat
gccgaagagctggccgagtcgggaggattggggacaatcattcccgacctcctccccgaa
gaatcgacgcgctgggcagaggcatgccacgagcacggattggcgcctatctaccttgtt
gctccctcgacgagccctgagcggatggcactcacggtgggagcaggtgacggctttgtg
tacgcagcctcgcatatgggggtcacaggtgcccaagagtcagtaaacagcggtgcgcgt
gacctcgtgaatcgcgtgcgggagcacaccgacctccccgttgcagtcgggttaggcgtc
agcaatgggcagcaagccgcagagatcgcgcagtatgccgacggcgtcatcgtcggttcg
gcacttatccgcgcggcgaaggatggtctccgctcgctcgaggcgttggcgaaagaactc
agcgaaggggtgaggggtgactaa

DBGET integrated database retrieval system