KEGG   Corynebacterium kroppenstedtii: ckrop_0797Help
Entry
ckrop_0797        CDS       T00896                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ckrop_0797 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ckrop_0797 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ckrop_0797 (trpA)
Enzymes [BR:ckp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ckrop_0797 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
938727..939530
Genome map
AA seq 267 aa AA seqDB search
MAAFSSDSPAGALRDVFAQARGEQRAAFIGYLPSGYPTKHDSDELMACLASYADVIEVGI
PFSDPMMDGPVIQEAGMAALKAGFRVKDSLSSVRKITDAGGRSVVMSYWNPILQYGPEKY
AEELAESGGLGTIIPDLLPEESTRWAEACHEHGLAPIYLVAPSTSPERMALTVGAGDGFV
YAASHMGVTGAQESVNSGARDLVNRVREHTDLPVAVGLGVSNGQQAAEIAQYADGVIVGS
ALIRAAKDGLRSLEALAKELSEGVRGD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcggcattttcttctgattcccccgcaggggcgcttcgcgacgttttcgcacaggcc
cgcggcgagcaacgagctgcgttcatcggttatctgccatcggggtacccgacgaagcac
gactctgacgagttgatggcgtgcctggcgtcctatgcggacgtcatcgaggttggaatt
ccgttctctgaccccatgatggacggtcctgtcatccaggaagccggcatggctgcattg
aaagcaggttttcgcgtcaaagattcactcagctctgtccgtaagattaccgacgccggt
ggtcgaagcgtcgtcatgagctactggaacccgatcttgcagtatggcccggaaaaatat
gccgaagagctggccgagtcgggaggattggggacaatcattcccgacctcctccccgaa
gaatcgacgcgctgggcagaggcatgccacgagcacggattggcgcctatctaccttgtt
gctccctcgacgagccctgagcggatggcactcacggtgggagcaggtgacggctttgtg
tacgcagcctcgcatatgggggtcacaggtgcccaagagtcagtaaacagcggtgcgcgt
gacctcgtgaatcgcgtgcgggagcacaccgacctccccgttgcagtcgggttaggcgtc
agcaatgggcagcaagccgcagagatcgcgcagtatgccgacggcgtcatcgtcggttcg
gcacttatccgcgcggcgaaggatggtctccgctcgctcgaggcgttggcgaaagaactc
agcgaaggggtgaggggtgactaa

DBGET integrated database retrieval system