KEGG   Corynebacterium kroppenstedtii: ckrop_0945Help
Entry
ckrop_0945        CDS       T00896                                 

Definition
hypothetical protein
Orthology
K06443  
lycopene beta-cyclase [EC:5.5.1.19]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Carotenoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    ckrop_0945
Enzymes [BR:ckp01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.19  lycopene beta-cyclase
     ckrop_0945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1127228..1128535
Genome map
AA seq 435 aa AA seqDB search
MHFSVVGLGPAGTAASLAALCSGYSVECWDPHGPHYPPTMGAWAHQIPRWLRQHPHPYLS
QSRPRVYGDDWDAVLPETYVILNPDALRDRLWDAGDTQSLFHDEWYDSRHDDADVVIDTR
ASSGGFLPVRQLAVGLILPERFLPRDHRQPVLMDMRTLPDSASSSHPTSDDGASTTAHPG
VDVPSRMTFNYRMPLGHGRWLIEETIVATLCRGPEHSPHSETAQLEYLRWALDRRLEQLG
VDPEIARRHAVREEVVSFPVAPLRRRIPHVARRNNGVTSIFPWGAAAGLMHAATGYSIGA
AVDRADKEIGWAAHWARYPRLLQRTVGAVHGPPGGWVAGWLQRRGLNATLQLKPDEMRLF
YREFFAMSPPRIRDYLTSSHGLDIARAMVSVVARLVWVMIKPDGDSRQERKAKRALARRT
FMSLLRGSTTPLPRR
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcatttttcggtggtcgggctaggtcctgcaggaacagcagcgtctcttgctgcgctc
tgttccggttattcggtggaatgctgggacccacatggcccgcattatccgccgacgatg
ggtgcctgggcacaccaaataccgcgatggctacgtcagcatccgcatccatatctttcc
cagtctcggccacgtgtgtacggcgatgattgggacgccgtcctcccggaaacgtatgtc
attctcaatccggatgcgttacgcgaccggttgtgggacgcgggtgacacgcaatctctc
tttcatgacgagtggtatgactccaggcatgacgacgcggacgtggtcattgatacacgc
gcgtcgagcggtggtttcctcccagttcggcaactcgcggtagggctaatcctccccgag
cgttttctaccgcgcgaccaccgtcagccagtgctgatggacatgcgaacattacctgac
agtgcttcttcttcccacccgacatccgacgacggtgcatcgacgacggcccatccaggc
gttgatgtgccttctcgtatgacgtttaactatcggatgcctctggggcacggccgatgg
ctgatcgaggaaacaattgtcgcaacactgtgccgaggtcccgagcactcgccccattct
gaaacagcacaattggaatacctgcggtgggcactggataggagactcgagcagctcggt
gttgatccggaaatcgcgcgtcggcacgctgttcgcgaggaagtcgtgagttttcccgtc
gcacccctacgccgacgaatcccgcacgtagcacgtcgaaacaatggtgtgacaagcatt
tttccgtggggtgcggccgcgggactgatgcacgctgccactggatacagtatcggagct
gcggtagatcgcgctgataaagagatcggctgggctgcccattgggctcgatacccgcgc
cttcttcaacgtaccgtcggagcagtacacgggcctcccggaggatgggtggcagggtgg
cttcaacggcgtggtttgaacgcaactctccaactgaagccagatgaaatgcggcttttt
taccgtgagtttttcgccatgtctccgccccggattcgcgattacctgacgtcctctcac
gggttggatatcgcccgagctatggtgtccgtcgtcgctcgcctcgtgtgggtgatgatt
aaaccggacggagattcacggcaagaacgtaaagccaaacgggcactggcccgacgcacg
tttatgtctttgttgcgtgggagtaccaccccgctcccacgtcggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system