KEGG   Corynebacterium kroppenstedtii: ckrop_0967Help
Entry
ckrop_0967        CDS       T00896                                 

Gene name
tpi
Definition
(RefSeq) Triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ckrop_0967 (tpi)
   01230 Biosynthesis of amino acids
    ckrop_0967 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ckrop_0967 (tpi)
   00051 Fructose and mannose metabolism
    ckrop_0967 (tpi)
   00562 Inositol phosphate metabolism
    ckrop_0967 (tpi)
Enzymes [BR:ckp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ckrop_0967 (tpi)
Exosome [BR:ckp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ckrop_0967 (tpi)
  Exosomal proteins of bladder cancer cells
   ckrop_0967 (tpi)
  Exosomal proteins of melanoma cells
   ckrop_0967 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1151498..1152295)
Genome map
AA seq 265 aa AA seqDB search
MKGLFMARKPLIAGNWKMNLNHLEAISVVQKLAFALPKDYYDKVDVAVIPPFTDIRSVQT
LVDGDKLRVTYGAQDISTHDSGAYTGEIAPSMLSKLGCSWVIVGHSERRDYHSETNEIVA
AKTKKALDADMTPIVCVGESLDVREAGKHVSFVVDQVKESLAGLSKDEIAKSVIAYEPIW
AIGTGKTASASDAQEVCHAIRGALAELTDEETASSIRILYGGSMKTGNVSELIAEQDIDG
GLVGGASLDGEDFAKLSALAADGSV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggactgttcatggctcgtaaaccacttattgctggtaactggaagatgaacctc
aaccaccttgaggctatctccgtggtacagaaactcgcttttgcactccccaaggactac
tacgacaaggttgatgtcgcggtcattcctccgtttaccgacattcgttcggtgcagact
ttggtggatggggacaagctgcgcgtcacctatggcgctcaggacatctcgacccacgat
tccggtgcgtacaccggtgaaatcgcaccgtcgatgctgtccaagttgggatgctcctgg
gttatcgtgggccactcagagcgccgcgactaccactccgagaccaacgagatcgttgct
gcgaagaccaagaaggctctcgacgccgatatgaccccgatcgtttgtgtcggagagtct
ctggacgttcgcgaggcaggcaagcacgtctccttcgtcgtcgaccaggtcaaggagtca
cttgccgggttgagcaaggacgaaatcgcaaagtctgttatcgcttatgaacccatctgg
gcgatcggaacgggtaaaaccgcatcggcttcggatgctcaggaagtgtgccacgctatt
cgtggtgccctcgctgagctgacagatgaggagacggcatcgtcgatccgcatcctgtac
ggaggctccatgaagaccggcaatgtttccgaactcattgcggaacaagatattgacggc
gggcttgttggtggtgcttcactcgatggtgaagacttcgccaagctctctgccctcgct
gccgacggtagcgtttaa

DBGET integrated database retrieval system