KEGG   Corynebacterium kroppenstedtii: ckrop_0976Help
Entry
ckrop_0976        CDS       T00896                                 

Definition
GTP cyclohydrolase II / 3,4-dihydroxy-2-butanone 4-phosphate synthase (EC:3.5.4.25)
Orthology
K14652  
3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Class
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:ckp00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1161386..1162771)
Genome map
AA seq 461 aa AA seqDB search
MEQHAVTTHHTDLAEPQSHSHDQRSDSQDSHTYRGNIQLNTIDEAIRDIAAGKPVIVVDD
EDRENEGDMIIAADRITATSLAFMVRYSSGYVCVGMTDDDADRCDLPPMVTRNQDKKSTA
YTVTVDAAEGGTTGISATDRAHTIRLLASPDSGPADFTRPGHVVPLRARPGGVLVRAGHT
EAAVDLARLAHLNPAGALCEVVSEDDPTTMARGPELRRFADEHSLTMISIDQLIAYRRNT
EQLVERVVETTLPTSYGRFTAIGYRNVIDGLEHVALVVGDPSDNGGEDVLVRVHSECLTG
DVFGSRRCDCGDQLHQAMEEVYKEGRGVVLYMRGHEGRGIGLLNKLQAYKLQDDGYDTVD
ANIELGKPADAREYGTGSAILSDLGVKSMILLSNNPTKRAGLKGHGLRIRGRRSIEVNVY
PENLNYLRTKRDKMGHDLPSLNAWEAAHTPGHAEPSNNPPE
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggaacagcacgccgtgactacacaccacaccgatctcgcagagccccagagccactcc
cacgatcaacgctctgattctcaggattcgcatacgtatcgcggaaatatccagctcaac
accattgacgaggctatccgcgacattgcagcaggcaagccggtgatcgtcgtcgatgac
gaggatcgcgaaaacgaaggcgatatgatcatcgctgccgatcgaattactgcgacatcg
ctcgcgttcatggtgcgatattcgtcggggtatgtgtgcgtcggcatgactgatgacgac
gctgaccggtgcgatctcccgcccatggtgacacgaaaccaggacaagaaaagcacggct
tatacggtcaccgtcgacgcggcagaaggcggaaccaccggtatctcagccaccgatcgc
gcgcataccattcggctactcgcgtctcctgactccggccccgcggatttcacacgaccc
ggccatgtggtccctcttcgagctcgaccaggaggagtccttgttcgcgccgggcatacc
gaggctgccgtcgacctcgcgcgcctcgctcacctcaatcctgccggtgcgctctgtgag
gtagtgagtgaagacgatcccacgaccatggcacgaggacccgagttacgtcggtttgcc
gacgaacattcgctcacgatgatctccatcgaccagctcatcgcttaccgacggaacacg
gagcagcttgttgagcgtgtcgtagaaaccacacttccgacgtcgtatggccggtttact
gccatcggatatagaaacgtcatcgacggactcgagcacgtagccctcgtcgtcggtgat
ccctctgataacggtggggaagatgtcctcgtgagagtccactccgaatgcctcaccggt
gatgtttttggttcgcgccggtgtgattgtggcgatcagctccatcaagcaatggaagag
gtgtacaaggagggacgcggcgtcgtcctgtatatgcgtggtcacgaggggcggggcatt
ggtcttctgaacaagctgcaggcctataagctgcaagatgacggttatgacactgtagac
gccaacattgaactgggtaagccggctgatgcgcgtgaatacgggacaggctccgccata
ctctccgatctcggcgttaaatccatgattctcttgtccaataatccgacgaaacgagcg
gggctgaaggggcatggcttacgaatcaggggacgtcgaagtattgaggtcaatgtgtac
ccggaaaacctcaattatcttcgcactaagcgcgacaagatgggccacgatttgcctagt
ttgaatgcttgggaggccgctcatacgccgggtcacgccgaaccgtctaacaacccgccg
gaataa

DBGET integrated database retrieval system