KEGG   Corynebacterium kroppenstedtii: ckrop_1030Help
Entry
ckrop_1030        CDS       T00896                                 

Definition
holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ckp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1225811..1226434)
Genome map
AA seq 207 aa AA seqDB search
MIDSLHGEVLHVGLNYVVIECSGVGYRATASPSLLGTLRKGEDARILVTMNVRDDGIDLY
AFESDEARQMFAMLRKVSGVGPTSAMAICSIFKPDEFARIITDEDDAELRNVKGIGKRTA
ERIIVDLKSKVAVFDSGDSASEPQSGVGGNSEAEVDSGVVGTVTQALVELGFPEKQAEKT
ATSAAAEGGSVSEILKRALRSMSSERN
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgattcattgcatggcgaggttcttcatgtcggtcttaattatgtcgtgattgaa
tgttcgggcgtcggttatcgagcaactgcgtcgccctcattgctggggacgctgcgcaaa
ggggaggacgctcgaatccttgtcacgatgaatgttcgcgacgatgggattgacctttac
gcttttgaatccgacgaggcccgtcagatgtttgcgatgctccgtaaggtttcgggggta
ggaccgacatccgcaatggcgatttgctctatttttaagcccgacgaattcgctcgaata
attaccgacgaggatgacgctgaactaagaaatgtcaagggcataggtaaaagaacagcg
gagagaatcatcgtcgacttaaagtcgaaggtagctgtattcgattctggagattcggct
agcgaaccgcaatcgggagtgggcggaaattcggaggccgaggtagacagtggcgttgtg
ggtacggttactcaagctcttgtcgaactaggttttccggaaaaacaggccgaaaagact
gccacgtccgctgcggctgagggaggatctgtgtcggagattctgaagcgcgccttgcga
tcgatgtcatccgagaggaactaa

DBGET integrated database retrieval system