KEGG   Corynebacterium kroppenstedtii: ckrop_1048Help
Entry
ckrop_1048        CDS       T00896                                 

Definition
Protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ckrop_1048
Enzymes [BR:ckp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     ckrop_1048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1242554..1244023)
Genome map
AA seq 489 aa AA seqDB search
MVKTRVAVIGGGLSGLVAAYEISRRDPDTDVVVFEASDTVGGKLKTVDLATGSVDVGAEA
YLAFRADATRFFTSLGLKDRLRYPSDLKSGLWIGDGTLHSVPSRTVMGIPADSSSVKDLV
DSETCARIDAEGEAYSIPWVEGEDALLGALVAERMGQQVVDHVVSPLLGGVYSSRAEDLG
LRATIPELAAAMDDLANHGEPVTLTRAAAAVLQQRDEAREARVAGGAADEESPSASAKKP
PVFASFVGGYRDLIDALVEQSSATIRVNAPVAAVLPAEESSAHRFRVVSGSSSTETEDFD
AVVVATPADVAGQQLTEVAPVAADILGSMDLASSVVLGLRLPNDEAIPETTGILVSPDAG
LHAKAFTFSSRKWPHVDDHVGAFIRTSFGHWGDDSLVREDEDTLVKYAIDDLETITGQRL
HPEETVLQKWWGGLPRYGMGHDELINVALKDISQVEGLEAAGAIWHGVGVPACIAQAREA
AKKVMDTVM
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaagacgcgtgttgcggttattggtggaggactgtcgggacttgtcgcggcttat
gaaatcagtcgtcgcgaccccgataccgacgtcgttgtttttgaagcctccgacacggtc
ggtgggaaactgaagaccgttgatctcgctaccggcagtgttgatgtgggggcagaggcg
tacctcgccttccgtgccgacgccacccggttctttacttccttggggttgaaagaccgg
ctgcgctatccatccgacctcaaatccggcttatggattggcgacggtaccttgcattcc
gttccgtcacgaacggtgatgggaattcccgccgatagttcctctgtgaaggacctcgtt
gattccgagacctgcgcacggattgatgctgagggggaggcatactcgataccgtgggtg
gaaggggaagatgccttactcggtgcgttggttgccgagcgaatggggcagcaggtcgtg
gaccacgtagtctccccgttgctgggtggggtctattcgtcccgcgctgaggacctcggt
ctacgagcgacgattccggaattagctgcggcaatggatgaccttgccaaccatggcgaa
cctgtgacattaacgcgagcggctgctgctgtcctacagcaaagagatgaagcacgtgaa
gcacgagtagccgggggcgcggcagatgaggagtcgccgagtgcgtcggcgaagaagcct
ccggtgttcgcgtctttcgtcgggggctatcgtgatctgatcgatgcgctggttgagcag
tcgtcggcaaccattcgtgtgaatgcacctgtcgctgcggtattgccggcagaggaatca
agtgcccatcgtttccgcgtcgtgagtggttcgtcgtcgacagagactgaagatttcgac
gccgttgtcgtcgccactccagcggatgtcgcgggccagcagctcactgaggttgcccct
gtggcagcagacattctcggttcgatggatctagcgtcgagcgttgtacttggtctacgt
ctgccgaatgacgaggctatcccagagaccacgggtattctcgtgtcacctgatgcgggg
cttcacgctaaagcctttactttctcttcgcgtaagtggccccacgtcgatgatcacgtt
ggtgctttcattaggacttcgttcggccattggggcgacgattcactcgtcagagaagac
gaagacacactggtgaaatacgctattgacgacctcgaaaccattacaggccaacgcctg
caccccgaagagacggtgcttcaaaagtggtggggtggtttgcctcgatacggcatgggt
cacgatgaactcatcaatgtggcgcttaaggatatcagtcaggtcgaggggctagaagct
gcaggtgctatctggcatggcgtcggcgttccagcgtgtatcgcgcaagcgcgtgaggcg
gcgaagaaggtgatggatacggttatgtga

DBGET integrated database retrieval system