KEGG   Corynebacterium kroppenstedtii: ckrop_1060Help
Entry
ckrop_1060        CDS       T00896                                 

Definition
polyphosphate glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ckrop_1060
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ckrop_1060
   00520 Amino sugar and nucleotide sugar metabolism
    ckrop_1060
Enzymes [BR:ckp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     ckrop_1060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1253927..1254706
Genome map
AA seq 259 aa AA seqDB search
MKSATIGVMNNYGFGIDVGGSGVKGAIVDLDNGTFVGERIKILTPKPSTPDAVADTCRQI
VEQAEWTGPVGITIPAIVKQQQARSAANIDKSWIDTDVSELFHRHIGPTRDIAVLNDADA
AGIAEVAYGNPIARKGSVIFLTFGTGIGSALLINGQLYPNSELGHLNIDGKEAERRASSA
VKERKDLSYKEWAKRVDRVLKEYEKLFSPTTFVAGGGISRKHEKWIPRLTCETTVVPAEL
LNRAGIVGAAMAARDHICP
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccgctactatcggagttatgaataattacggctttggtatagatgtcggcgga
agcggagtaaaaggcgcaattgttgatctcgataacgggactttcgtcggagagcgaatc
aagattcttacaccaaagccgtcgactcccgacgctgtcgctgacacatgccgtcagatc
gttgagcaggcagaatggacgggccctgttgggatcaccattcccgcaattgtgaaacaa
cagcaagctcgtagcgcggcaaatatcgacaaatcgtggattgataccgacgtgtcggag
ctcttccaccgccatattgggccaacccgcgatatcgctgtcctcaatgacgcggatgct
gccggaatagcagaggtggcctacgggaaccctattgcgcggaaaggctcggtcattttc
ctgacttttggtacaggaatcggctccgccttgctcattaacgggcaactgtatcccaat
agtgagttaggtcatttaaacattgatggtaaggaagctgaacgacgcgcctcctcggct
gtcaaagagcgcaaagacttgtcatataaagaatgggcaaaacgcgtggaccgagtcctt
aaagagtacgaaaagctcttttctcccacgacgtttgtggccgggggcggcatatcacgc
aagcatgaaaaatggattccgcgattgacatgcgaaacgacagtcgtgcccgctgaactt
ctcaaccgagccggaattgtaggcgcggcgatggcagcgcgtgaccatatttgtccataa

  All links  
No link information was found.   
DBGET integrated database retrieval system