KEGG   Corynebacterium kroppenstedtii: ckrop_1249Help
Entry
ckrop_1249        CDS       T00896                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ckrop_1249 (pfkA)
   01230 Biosynthesis of amino acids
    ckrop_1249 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ckrop_1249 (pfkA)
   00030 Pentose phosphate pathway
    ckrop_1249 (pfkA)
   00051 Fructose and mannose metabolism
    ckrop_1249 (pfkA)
   00052 Galactose metabolism
    ckrop_1249 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    ckrop_1249 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ckrop_1249 (pfkA)
Enzymes [BR:ckp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ckrop_1249 (pfkA)
Protein phosphatases and associated proteins [BR:ckp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ckrop_1249 (pfkA)
Messenger RNA biogenesis [BR:ckp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ckrop_1249 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1488024..1489055)
Genome map
AA seq 343 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTASSEYGSTVVGYEDGWVGLLEDRRIQLYDDEEIDR
VLLRGGTILGTGRLHPDKFREGIEQIKENLENAGVDALIPIGGEGTLKGALWLHENGIPV
VGVPKTIDNDVNATDYTFGFDTAVSVATDAIDRLHTTAESHNRVMVVEVMGRHVGWIALH
AGMAGGAHYTVIPEVPFDIDEICKAMERRFQMGEKYGIVVVAEGARPKEGTMELKTGGID
QFGHEVFTGVGQQVADAIHERLGHDVRTTVLGHIQRGGTPTAYDRVLATRYGVHACRAAH
EGKYGTVASLQGESIGLVSLQDAVGTLKVVPIERYEAAAALFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattgcgactcttacctccggtggtgattgcccgggacttaacgcggtgattcgt
ggaattgtccgcaccgcgagttctgaatatggctccaccgtggtcggctatgaagatggc
tgggtggggctcctcgaggatcgccgaattcagctctacgacgatgaggagattgaccgg
gttctcctccggggtggaactatcttgggcacgggccgtttacaccctgacaaattccgc
gaaggaattgaacagattaaggaaaacctagagaacgcgggggtcgatgcattgatcccc
atcggcggcgagggaacgcttaagggtgctctctggctccatgaaaacggaattccggtg
gtcggtgtccctaaaaccatcgataacgacgttaatgcgacggactacaccttcggtttc
gataccgccgtctccgtcgccacggatgcgattgaccgtttgcacaccaccgcagagtcg
cacaatcgtgtgatggtcgtggaggtcatgggccggcacgtcggctggattgccctccac
gccggtatggctggtggtgcccactacaccgtgatccccgaagttccgttcgatatcgac
gagatctgtaaagccatggaacgtcgtttccagatgggggagaaatacggaatcgtcgtc
gtcgccgagggtgcccgcccgaaagaaggcaccatggaactgaagacgggcgggatcgac
cagttcggccacgaggtattcaccggcgttggccagcaagttgccgacgctatccatgag
cgcctgggtcacgatgtccgtaccacggtgttgggacacatccagcgcggtggtacgccg
acggcttatgatcgcgttcttgccacgcgctacggtgttcacgcttgccgcgctgctcac
gaaggtaagtacggaaccgtcgcttccctccagggagagagtattgggctggtcagcctc
caggatgccgtgggcacgctgaaggttgttccgatcgagcggtacgaggccgcggctgcc
ctgttcggttaa

DBGET integrated database retrieval system