KEGG   Corynebacterium kroppenstedtii: ckrop_1268Help
Entry
ckrop_1268        CDS       T00896                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ckp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1511367..1513541
Genome map
AA seq 724 aa AA seqDB search
MPTIDPNDRARILAGTHYNPHSVLGAHPHDDGTTTITAFRPGAESVTVETPSETVDAVND
GDGFFTASIHGGATDHRLHITYPDGETITIANGYTWLPTLGEMDIHLIGEGRHERLWEVL
GAHVRHYETEMGSVDGTSFAVWAPNAQGVTVTGSFCAWNKNQFPMRSLGSSGIWEVFIPN
VAAGAYYKFCVTTPDGNRIDKADPMARRAEVPPATASIVADSDYSWSDDEWMAEKTRKNL
QDSPISIYEVHLESWHKGLSYTELADELVSYVSDIGYTHVEFMPVTEYPFSGSWGYQVTS
YYAPTSRFGTPDEFRALVDAFHEAGIGVIMDWVPGHFPKDEWALARFDGRACYEHPDWRR
GEQKDWGTYVFDFGRAEVRNFLVANALYWVDQFHIDGLRVDAVASILYLDYSRKEGEWLP
NQYGGRENLDAVQFLQEMNATVERAYPGTMTVAEESTSWPGVTAPTYEGGLGFTFKWNMG
WMHDTLEYISNDPIYRPWHHGDITFSLVYAWSEKFILPISHDEVVYGKGTLWSRMPGDTW
NKAAGLRTYLAFMWAHPGKQLLFQGQDFGQTTEWNHDESLPWGQQEGWEGEYHAAVSRLV
KDLNGLYSATPALYTQDNEPSGFSWINASDAQRGVLSFMRYGSNGQRVACVFNFSGTTYP
QYQLGLTNAGRWTEVLNTDSSDYEGAGGGNLGQITANSGEYDGYPASATIFVPAMSALFF
RFDG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgccaactatcgacccgaatgaccgcgcacgaatacttgcaggtacccattacaacccg
cactccgttcttggggcacacccccacgacgacggaacgacgaccatcacggcgtttcgg
cccggcgcggaatcagtcaccgtggagaccccgtccgagactgtcgacgcggttaacgac
ggtgatggtttctttaccgcatccattcacggtggagcgaccgaccaccggctgcacatc
acgtatcccgatggtgagaccataacgattgctaacgggtacacgtggctacccacactc
ggggaaatggatatccacctcatcggcgagggacgccacgagcgcctgtgggaagtgctg
ggtgctcatgtccgccattacgagaccgagatggggagcgtcgacggtacgtcgttcgct
gtgtgggcgccgaatgctcagggcgtgacagtgacgggttcgttttgcgcgtggaataaa
aaccagttccccatgcgctcgctggggtcgtcgggaatttgggaagttttcatccccaat
gtcgctgccggggcgtactacaaattctgcgtgaccacgcctgatgggaatcggatcgat
aaagccgatcccatggcgcggcgggctgaggtgccgccggctacggcgtcgatcgtggct
gatagtgattattcatggtccgatgatgagtggatggctgagaaaacgcggaagaatctc
caggactcgcccatttctatttacgaagttcacctggagtcctggcataagggcctttcc
tacacagagctcgcggatgaattggtgtcctatgtttcggatataggatacacgcatgtg
gaattcatgccggtcaccgaatatccgttctcggggtcgtgggggtaccaagtcacctcg
tattacgcccccacttcgcgtttcggtactcccgacgagttccgcgcccttgtcgatgcc
ttccacgaagcgggtatcggcgtcatcatggactgggtccccgggcacttccccaaggac
gagtgggcactagcccgcttcgacggccgcgcctgctacgagcaccccgattggcgacga
ggggaacaaaaggactggggtacctacgtcttcgacttcggacgagcggaggtacgcaac
ttcctcgtggcgaacgcattgtactgggtcgaccagttccacatcgacggactgcgtgtc
gacgccgtcgcctcgattttgtacctggattacagccgtaaagagggcgaatggctcccc
aaccagtacggtgggcgcgagaaccttgatgccgttcaattcctgcaggagatgaacgct
accgtcgagagggcctatcccgggacaatgaccgtggcggaggaatccacctcgtggcca
ggggtgacggcccccacgtacgagggcggcctgggctttacgttcaagtggaacatggga
tggatgcacgacaccctcgaatacatctccaacgaccccatttaccgcccctggcaccat
ggggatatcacgttttcgctggtctacgcctggtccgaaaagttcattcttcccattagc
catgatgaagtggtctacgggaaggggacgctatggtcacggatgccgggcgatacatgg
aataaggcagcagggctgcgcacctatctagcgttcatgtgggcgcaccccggcaagcaa
ctcttgttccaggggcaagactttgggcaaaccaccgagtggaatcacgacgagtctctg
ccgtgggggcagcaagagggctgggaaggcgaataccacgcagccgtatcacgcctggtc
aaggaccttaacggtctctactcggctacccctgcgctctacacacaagacaacgaaccc
agcggtttttcgtggattaatgctagcgacgcccaacgcggcgtgctgagcttcatgcgg
tacgggtcgaacgggcagcgcgtcgcgtgcgtattcaacttctcgggaaccacatatccc
cagtaccaattgggcctcaccaatgctggacggtggacagaagttctcaacaccgactca
tccgattatgaaggcgccggtggcggaaacctggggcagatcacggcgaatagtggtgaa
tacgacggctaccctgcctcagcgactatcttcgtgcccgccatgagtgccctgttcttc
cgcttcgacgggtag

DBGET integrated database retrieval system