KEGG   Corynebacterium kroppenstedtii: ckrop_1330Help
Entry
ckrop_1330        CDS       T00896                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ckrop_1330 (malQ)
Enzymes [BR:ckp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ckrop_1330 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1584351..1586573
Genome map
AA seq 740 aa AA seqDB search
MTYSEKLRSLSAHCGVATSYTDYRGSHVDVADETLEDTLHALGLSFSHDDAGIDAASQYF
YTKEATRSLPPTIIGVEGEDVTFPVHVIDGEPVDVWVVTEDGQRYDCHQIEDLTPARHVD
YPVDHAGEPLTDSESESGAAAHAPGAASYGQASFTLPKDLPLGWHTIYASSPTRGQAETT
LVIMPARLSAADDLVAHPQAGLMAQLYSVRDSGAWGIGDFYTLGTLARHAAEQGSSFILT
NPLHAAEPAPPVEDSPYLPTTRRYINPIYIRPGAIPEAAHLPDDAAEALQERGRRHYPEN
TSSAYINRNPIYADKLLSLKDIYDVERSATRQHAFDTFVEHEGEGLTHFAQWCADQAEPW
WREKLGHGEDDDSFPPSDYWVGFYQWLQWIVDEQLEAADVTARDSGMSLGLMADLAVGVH
PGGSDAEALAPYLAPDCSVGAPPDGYNQVGQDWSQPPWHPWKLAEAGYRPWRDLLRTVLR
HAGGIRVDHILGLFRLWWIHRPVPGEAADPRAGTYVNYDHAAMVGILALEAERAGAVVVG
EDLGTFEPWVQDYLQSRGIMGTSILWFENDDDAPRHSENYRRLCLASVTTHDLPPTAGYL
DGEHVTLRQKLGILTSDPEEEDANDLEWQNRVLDTVREHGDFDGTPADVSYNGLARDERP
DSSAIIAGLHKFLAESPAALTCTSLVDIVHDRRVQNQPGTTADIYPNWRVPLCDGDGNAV
VLEDLFRSDEWAQPYFHSRR
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
gtgacctactcagaaaaactccgctccctcagcgcacactgtggcgttgcaacgtcctat
accgactatcgcggctcccacgtggacgtcgccgacgaaacactcgaggacaccctgcac
gcccttggcctgagtttttcccacgacgacgccggcatcgatgcagctagccaatacttt
tacaccaaagaagccacccgctcccttccccccactattattggagtcgaaggcgaggac
gtcaccttccccgttcacgttatcgacggcgagcccgtggacgtctgggtagtcaccgaa
gacggacaacgatatgactgccaccaaattgaggatctcacccccgcgagacacgtcgat
tatcccgttgaccatgctggggagccacttacggatagtgaatccgagtcaggcgcggcc
gctcatgctcccggtgcggcgagctacgggcaggcgtcatttactctcccgaaagacctg
ccactgggatggcacaccatttatgcgtcctcccccacacgcggccaggcagaaacgacg
ctcgttattatgcccgcccgcctctctgccgccgacgacctcgtcgctcatccccaagcg
ggcttgatggcgcagctgtattcagttcgcgattccggggcctggggaattggggatttc
tacaccctgggtacgctcgcccgccatgctgcagagcaggggagctcgtttatcctcact
aacccacttcacgctgcggaacctgctccgccggtggaggattccccgtaccttcccaca
acgcgtcgctatatcaacccgatttatattcgtcccggcgcgatccctgaggccgctcac
ctccccgacgacgccgccgaggctctgcaggaacggggtcgtcgtcattacccagagaac
acgtcgtcggcctatatcaaccggaaccctatttacgccgacaagttgctgagcttgaaa
gacatttacgacgtcgaacggtcggcgacgcggcaacacgcgttcgatacctttgttgag
catgagggcgagggcctcacccactttgcacaatggtgcgctgaccaggcagaaccgtgg
tggcgtgaaaagctcggccatggcgaggacgacgattcgttccctcccagcgactattgg
gttggcttttaccagtggctccagtggatcgtcgacgagcagctggaagcagccgacgtg
accgcacgtgatagcggaatgagtctcgggctgatggctgatctcgcggtgggagtccac
ccgggtggatcggacgcggaagcgctggccccctacctagcacccgattgttcggtaggc
gcaccgcccgatgggtataaccaagtgggtcaggactggtcccaacccccgtggcacccg
tggaagctagcggaagcagggtatcgcccgtggcgtgacctgttgcgcactgtcctccgc
cacgccggaggtatccgggttgaccacatcttggggctctttcgcctgtggtggatacac
cgccctgtacctggagaggcagctgatccccgcgccgggacgtacgtgaactacgaccac
gcggcgatggtgggcattcttgcgctggaggcggaacgcgccggtgccgtcgtcgtcggt
gaagatctcggcacattcgagccgtgggttcaagactatttgcaatcgcgcggcatcatg
gggacgtcgattctctggtttgaaaatgacgacgatgcgccgcgtcactccgagaattat
cgacgcttgtgcttggcgtcggtcacgactcatgatttgcccccgaccgccggatactta
gacggcgagcacgtgacgctgcgccagaagctgggaatattgacgtcggatccggaagaa
gaggatgcgaacgacctggagtggcagaaccgcgttcttgacacggtgcgcgagcacggt
gacttcgacgggactcctgccgacgtgtcctacaacgggctggcgcgggatgaacggcca
gattcgtcggccattattgctgggcttcacaaattcctggcggagtcgcccgcggcgctg
acctgcacgagtttggtcgacattgttcacgatcggcgagtacagaaccagccgggaacc
acggctgatatctaccccaactggagggttccgttgtgcgatggtgatgggaatgcagtg
gtgctggaggacctatttaggtccgatgagtgggcgcagccctatttccactcgcggcgg
tga

DBGET integrated database retrieval system