KEGG   Corynebacterium kroppenstedtii: ckrop_1352Help
Entry
ckrop_1352        CDS       T00896                                 

Gene name
gpmB
Definition
(GenBank) phosphoglycerate mutase
  KO
K22306  
glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
ckp  Corynebacterium kroppenstedtii
Brite
Enzymes [BR:ckp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     ckrop_1352 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1608453..1609253)
Genome map
AA seq 266 aa AA seqDB search
MARRLILLRHGQTDYNATGRMQGQMDTHLSDLGRQQAQRTAGELSRWDIRRVVTSDLSRA
AETAGLIAAPHGLTPVLDERLRETHLGAWQARSHEEIDAAHPGQRAMWRHNPHWAPPGGE
TRLEVAARARSLVDELMHSFPEWEGGTVVCVAHGGTIAGLTCSLLGLPTDNYSSFSGLGN
TSWAQLTARPRFHYDHSTVDNSGDRPADPALDTTPVATFSESTIDDAQWHLDAWNASALG
IPFAPAQPGSEGVGVTYTRTSIEGLQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggctcgccgccttattcttcttcgacacggccagacggattacaacgccactggccgc
atgcagggccagatggatacgcacctcagcgatctggggcgacagcaagcccagcggacg
gctggcgaactcagtcggtgggatatccgacgagtggtgacctctgacctgtcgcgagca
gcggaaactgcagggctgattgcggcccctcatgggctcacccccgtgctcgatgagcgc
ttgcgtgagacccatttgggggcgtggcaggcccgttcgcatgaggagattgatgctgct
caccctggtcagcgcgcgatgtggcggcataaccctcattgggccccgccgggtggtgag
acccgtcttgaggtcgctgcccgtgcccgcagccttgttgatgagctcatgcactcgttc
cccgagtgggaaggcggcacggtcgtgtgcgtggcccacggaggaacgatcgccggcttg
acctgctcattattgggattgccgacggacaactactcgtcattttcggggttggggaat
acgagttgggctcagctgacggcgcgcccacgtttccactacgaccactcgaccgtcgac
aattccggtgaccgaccggcggatccagcgttggatacgaccccggtggcgacgttctct
gaatcgactatcgacgatgcgcagtggcatctggacgcctggaatgcgtccgcgctgggt
attccctttgcgcctgctcaaccaggtagtgagggcgtcggcgtgacctataccaggacg
tcgatcgaggggctgcagtga

DBGET integrated database retrieval system