KEGG   Corynebacterium kroppenstedtii: ckrop_1352Help
Entry
ckrop_1352        CDS       T00896                                 

Gene name
gpmB
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ckrop_1352 (gpmB)
   01230 Biosynthesis of amino acids
    ckrop_1352 (gpmB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ckrop_1352 (gpmB)
  Energy metabolism
   00680 Methane metabolism
    ckrop_1352 (gpmB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ckrop_1352 (gpmB)
Enzymes [BR:ckp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     ckrop_1352 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1608453..1609253)
Genome map
AA seq 266 aa AA seqDB search
MARRLILLRHGQTDYNATGRMQGQMDTHLSDLGRQQAQRTAGELSRWDIRRVVTSDLSRA
AETAGLIAAPHGLTPVLDERLRETHLGAWQARSHEEIDAAHPGQRAMWRHNPHWAPPGGE
TRLEVAARARSLVDELMHSFPEWEGGTVVCVAHGGTIAGLTCSLLGLPTDNYSSFSGLGN
TSWAQLTARPRFHYDHSTVDNSGDRPADPALDTTPVATFSESTIDDAQWHLDAWNASALG
IPFAPAQPGSEGVGVTYTRTSIEGLQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggctcgccgccttattcttcttcgacacggccagacggattacaacgccactggccgc
atgcagggccagatggatacgcacctcagcgatctggggcgacagcaagcccagcggacg
gctggcgaactcagtcggtgggatatccgacgagtggtgacctctgacctgtcgcgagca
gcggaaactgcagggctgattgcggcccctcatgggctcacccccgtgctcgatgagcgc
ttgcgtgagacccatttgggggcgtggcaggcccgttcgcatgaggagattgatgctgct
caccctggtcagcgcgcgatgtggcggcataaccctcattgggccccgccgggtggtgag
acccgtcttgaggtcgctgcccgtgcccgcagccttgttgatgagctcatgcactcgttc
cccgagtgggaaggcggcacggtcgtgtgcgtggcccacggaggaacgatcgccggcttg
acctgctcattattgggattgccgacggacaactactcgtcattttcggggttggggaat
acgagttgggctcagctgacggcgcgcccacgtttccactacgaccactcgaccgtcgac
aattccggtgaccgaccggcggatccagcgttggatacgaccccggtggcgacgttctct
gaatcgactatcgacgatgcgcagtggcatctggacgcctggaatgcgtccgcgctgggt
attccctttgcgcctgctcaaccaggtagtgagggcgtcggcgtgacctataccaggacg
tcgatcgaggggctgcagtga

DBGET integrated database retrieval system