KEGG   Corynebacterium kroppenstedtii: ckrop_1388Help
Entry
ckrop_1388        CDS       T00896                                 

Gene name
deoA
Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
ckp00240  Pyrimidine metabolism
ckp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ckrop_1388 (deoA)
Enzymes [BR:ckp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ckrop_1388 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N TMP_2 Biotin_lipoyl_2 Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: ACR18128
UniProt: C4LJX3
Position
1656305..1657600
Genome map
AA seq 431 aa AA seqDB search
MAEHFDAVDVIRTKRDKGELSEGQIDWVIDAYTRGVVADEQMSALAMAIFLNGMNRREIA
QWTQAMINSGETMSFSSLSRPTADKHSTGGVGDKITLPLAPLVASFGVSVPQLSGRGLGH
TGGTLDKLESIPGWQANLSNDRMMQMLEDPGCVICAAGSGLAPADKKLYALRDITSTVDC
IPLIASSIMSKKIAEGTGALVLDVKVGSGAFMKTLDDARELAQTMVNLGTDAGVKTVALL
TDMSTPLGKTVGNALEVRESLDVLAGGGPADVVELTCELAREMLNLAGVHDADVEEALKN
GRAMDTWKSMIRAQGGDPDAPLPTAKHTETVYADADGVITELDALAIGVASWRLGAGRAR
KEDPVQAGAGIEILVDRGQKVTKGTPLFTLHSDDTDRFERALESLNQGWSIAPIDESVPT
PRQSVVIEKIN
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcatttcgatgccgtcgacgttatccgcaccaaaagagataagggggagctt
tccgaaggtcagatagattgggttatcgacgcgtacacccgcggagtcgtcgctgatgaa
caaatgtctgctctcgcaatggctatcttcctcaatgggatgaaccggcgagagatcgcg
caatggactcaggcgatgattaattccggtgagacgatgtcctttagctcactgtcgcgt
ccaacagcggataagcactcgacaggcggcgtgggtgacaaaatcaccctccccctcgct
ccactggtggcatcgtttggagtatcggttccgcagctctccggacgagggctcggccac
actggcggcacgctggacaaattggaatcaatcccgggctggcaggcgaatctgtctaac
gatcgcatgatgcagatgctcgaagaccccggatgcgtcatctgtgccgccggctcaggg
ctcgcaccagcggataaaaagctctatgcactgcgcgacatcaccagcactgtggactgc
atccccctgatcgcaagttcaatcatgagcaaaaagatcgcggagggcacgggcgcgctc
gttctcgatgtaaaagttggttcaggagctttcatgaaaactcttgacgacgcgcgcgaa
ctggctcaaacaatggtgaacctgggaaccgacgccggggtcaaaaccgtcgcactgctc
acagatatgtccacgccactggggaagactgtcggaaatgccctcgaggtcagggaatcg
ctggacgttctcgctggtggagggcccgccgacgttgtcgagctaacctgcgaattagcc
cgtgaaatgctcaatttggccggagttcacgacgctgacgttgaagaagctttgaagaat
ggccgtgcaatggacacctggaagtccatgatccgcgcccagggcggcgatcccgatgcc
ccactgcccaccgcgaaacacacagaaactgtgtacgcggatgcagatggcgtgatcacc
gaactcgacgctcttgccatcggtgtggctagctggcgattgggcgccgggcgtgcacgc
aaagaagatccagttcaggctggcgctgggattgaaatcttggtggaccgcggccaaaag
gtcacgaaaggcacccccttgttcacgcttcattctgacgacacggaccgattcgaacgc
gctctggaatcactcaaccaaggctggagtattgctcctatcgacgagagcgttcctaca
ccacgtcagtccgtcgttatcgaaaaaatcaactag

DBGET integrated database retrieval system