KEGG   Corynebacterium kroppenstedtii: ckrop_1575Help
Entry
ckrop_1575        CDS       T00896                                 

Gene name
glsA
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ckp00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ckp00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:ckp00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1866335..1867702)
Genome map
AA seq 455 aa AA seqDB search
MKSMVTDYLDEVLEDVRPGDRGAPASYIPELANVDPERFGVSLATIDGKVYGSGDTETEF
TIQSIAKPFVYALALEDRGFRDVLKRVSVEPSGEAFNEVSLDEEGRPLNPMINAGALTTH
SLVGGDDWTQGQRLQRIIDGLSAFAGRRLQVDERVCGSELDHAHRNLSIAHMLRSYDIFP
QDPRVIVEGYTRSCSLLVSTRDLAIMAATLANKGINPITGEKVVSGRVVRQVLSVMTTCG
MYDAAGDWVTQVGIPAKSGVAGGLIGALPGQIGVATFSPRLDEHGNSVRGVRLFERMSRD
MGIHLMEVPPSVQTVIRNTTVLVQDLTDDEKSQGVKPQKIKVYSIQGSLRFAGAEKIVRE
FSSTTIKEPAVALDLTDVHALDGVARRMILEVARRLTLDGKRVYLIDPADVIPKPDPGDG
GQVIVVQDRAELRAHQPEKRKKGKKGKSAKKGKKK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccatggtcactgattatttggacgaggttctcgaggacgttcgcccaggtgat
cggggtgctcccgcgagctacattccggaactagccaatgttgaccccgagagattcggt
gtgagcttggcgacgatcgacggcaaggtgtacggctcgggtgataccgagaccgagttc
accattcagtcgatcgcgaagccatttgtgtatgcgcttgccctggaagaccgtggtttt
cgtgacgtgttgaagcgtgtcagcgtggaaccgtccggtgaggctttcaacgaggtgtcc
ctagacgaggaaggccgcccgctcaacccgatgattaatgcgggcgcgctgacgacgcat
tccttggtgggcggcgacgattggacccagggccagcgcttgcagcggatcatcgacggg
ttgtcagccttcgctggccgtcggctgcaggttgatgagcgggtgtgcggctcggagctg
gaccatgcccaccggaacttgtctatcgcccacatgctccgcagctacgacatattcccc
caggatccgcgcgtgatcgtggagggctacacgcggtcctgctctcttctggtatcgacg
cgggacctggcgatcatggccgcgaccttggcgaataagggcatcaacccgatcactggc
gagaaggtggtgtcgggtcgcgtggtccgccaggtgttgagcgtcatgacgacgtgcggc
atgtatgacgccgcgggcgactgggtgacccaggtcggcatcccggctaagtcgggcgtc
gcgggtggtttgatcggcgcgttgcctggtcagattggggtggcgacgttctcgcctcgg
ctggacgagcatggcaatagtgtgcgtggcgtccgcctgtttgagcggatgtcccgggat
atggggatccacctcatggaggttccgccgtcggtgcagacggtgatccggaacacgacg
gtgctggtccaggacctgactgacgacgaaaagtcgcagggggtgaagccgcaaaagatc
aaggtctattcgatccaggggagtttgcgtttcgctggtgcggagaagattgtccgcgag
ttctctagcacgacgattaaagagccggcggtggccctggacttgaccgatgttcacgcg
ttggatggggtcgcgcggcgcatgattctggaggtggctcgccgtttaactctggacggg
aagcgcgtgtatctgatcgacccggcggatgttattccgaagcccgatccaggtgatggt
gggcaggtcattgttgtgcaggatcgcgcggagctcagggcccatcagccggagaagcgt
aagaaggggaagaaaggtaagtccgctaagaaagggaagaagaaatag

DBGET integrated database retrieval system