KEGG   Corynebacterium kroppenstedtii: ckrop_1648Help
Entry
ckrop_1648        CDS       T00896                                 

Gene name
folXK
Definition
dihydroneopterin aldolase (EC:4.1.2.25)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ckp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1932806..1933675)
Genome map
AA seq 289 aa AA seqDB search
MADRIELTGVEVYGHHGVFPHEKRDGQWFLTDVTVWTDFRQAAATDDLMHTISYADIADL
IHATVGGPSRDLIETVASEIADTLILNNRVHAIEVTIHKPDAPIPHPFADVAVVARRSRK
DLRHVVLSLGSNITADGITPGQRVERAMHWFETSADYRVIATSSLYATPAWGGVEQADFM
NSVAVVETMKTPHDILDDAHELERDAHRTREVHWGPRTLDIDLITSINNGSEEHYDTDDL
TLPHPWAHQRAFVLKPWLEVEPHARLGRQSIASLLDNLDSREVGEVKPQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaccgaatagaactcacaggcgtcgaggtatatggacaccacggggtattcccg
cacgaaaaacgcgatggccagtggtttctcaccgacgtcacagtgtggaccgacttccga
caggccgccgccaccgacgacctcatgcacacgatcagttacgccgacatcgccgacctc
attcacgccactgtcggcgggcccagccgcgacctcatcgaaaccgtcgccagcgagatc
gccgacaccctcatcctcaacaaccgcgtccacgccatcgaagtcaccattcacaaaccc
gacgcgcccatcccgcacccgttcgcggacgtcgccgtcgtcgcacgtcgaagccgaaaa
gacctacgccacgtggtgctttccctcggctccaacatcactgccgacgggatcacccca
ggccaacgggtagaacgtgccatgcactggtttgagaccagcgcggactaccgcgttatc
gccacgtcctcgctgtacgcgacaccagcctggggcggcgtcgagcaggccgacttcatg
aactccgtcgccgtcgtcgaaaccatgaaaacaccccacgatattctcgacgacgcgcac
gaactcgaacgcgacgcgcaccgcacgcgcgaggttcattgggggcccaggaccctcgat
atcgacctcatcaccagcattaacaacggctccgaagaacactacgacacggacgacctc
acccttccacacccgtgggcacaccaacgtgccttcgtgctcaagccgtggttggaagtg
gaaccccatgctcggttagggcggcagagtattgcatccctgttggataacctggattcc
cgcgaggtaggagaggtgaaaccgcaatga

DBGET integrated database retrieval system