KEGG   Corynebacterium kroppenstedtii: ckrop_1650Help
Entry
ckrop_1650        CDS       T00896                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
ckp00790  Folate biosynthesis
ckp01100  Metabolic pathways
Module
ckp_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ckrop_1650
Enzymes [BR:ckp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ckrop_1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACR18375
UniProt: C4LKM0
Position
complement(1934632..1935198)
Genome map
AA seq 188 aa AA seqDB search
MAVDHERARAAVRDLLIAVGEDPDREGLVDTPERVARAYEEIFAGLHQDPSEVLTKTFNE
DHRELVLVRDIPVYSTCEHHLVPFYGKAHIGYIPGKSGKVTGLSKLARLVDLYAKRPQVQ
ERLTKQVADAMVNRLQPQAVIVVIECEHLCMAMRGIRKPGATTTTSAVRGGFQTNPASRA
EVLSLIRG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgaccatgaacgggcgcgggcagccgtccgcgacctgttaatcgccgtgggg
gaagaccccgatcgggaaggactcgttgacacccccgagcgcgtcgcacgagcctacgaa
gaaatcttcgccggcctccaccaagacccgtcggaagttctcaccaagactttcaacgaa
gatcatcgcgaactcgtgctcgtccgggacattcccgtgtactccacctgtgaacaccat
ctggtgccgttctacgggaaagcgcacatcgggtacatcccggggaaatcggggaaagtc
accgggctttccaaactggcccggctggttgacctctacgccaaacgaccacaagtgcaa
gaacgcctgactaagcaggtcgcagacgccatggtcaaccgcctgcaaccgcaagcggtc
atcgtcgtcatcgaatgtgaacacctgtgcatggccatgcgcggtatccgcaaaccgggg
gcgacaaccaccacctcggcggttcgtggagggttccaaacaaaccccgccagccgcgcc
gaagtactcagcctcatccgcggataa

DBGET integrated database retrieval system