KEGG   Corynebacterium kroppenstedtii: ckrop_1799Help
Entry
ckrop_1799        CDS       T00896                                 

Definition
phosphodiesterase/alkaline phosphatase D (EC:3.1.4.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ckrop_1799
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ckrop_1799
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ckrop_1799
Enzymes [BR:ckp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ckrop_1799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2100431..2102284)
Genome map
AA seq 617 aa AA seqDB search
MRNKERNNNQRPAATSSESTSAEGIRREAARPTGRPSYTRRSFLRSSLAAGGTIAAGSAL
VGRYPRAYAGDAPGSNAAPQNDSVDTDLFRHSVASGDPQPDSVIIWTRVTPSPEATPGSE
KGADTRVNWEVSTSPDFTKIVRSGYETSSASKDHTIKVDVKDLQPDTQYFYRFAVERDGK
PHYSRVGRTRTALGSGGERTVNFGVVSCSNYEAGYFRSYRDIAGRDDLEFVLHLGDYTYE
YETGGYNGAYDSQVRVVQPAERTTTLQDYRIRQGCYHEDPDLADCHAAKPFICIWDDHEF
ADNNWRDGAAGSSAEPDDNYQAIKAAAMQAYFEWLPVRVSAGNQGSHLYRKLQYGNLMEF
IIPDLRTYRDYELVYTNKKMFLKTDPDFIRAAGKDGRSMMGQTQFEWFGNVLSSSPTTWQ
MVANEVMFAPMTLPDGLDQRTHDWLVTQIGLPDQGIPLNTDQWDGYMAERQKIIDLIADT
KKNVVFLTGDIHSSWANDIPRDIQKYRTGASKDVVATEFVTPSITANGLFDTVAKSRALD
QAARQVSTTAADVLQKTNAWFKWIDFIHHGYMAVSVSSDAVSCEWLHVDNVLSPNTPFRS
ARKCTAYKDKPGVHTDA
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacaaggaacgcaacaacaaccagcggccagcggcaacgtcgtccgaatcgaca
agcgcggagggtattcgccgcgaagccgcgcggccgaccggacgtccttcgtacacgcgt
cgcagtttcttgcgctcatcgttagcggctggcggaaccatcgctgctggtagcgcgctc
gtcgggcggtatcctcgggcctacgcaggtgacgcgccgggatcaaacgcggccccgcag
aacgactccgtcgacactgacctcttccgccactccgtcgcgtcgggcgatcctcaacct
gacagcgtgatcatctggacacgcgtgacgccctcgcctgaggccaccccggggtcggaa
aagggcgcggatacgcgggtcaactgggaggtatccacgtcgccggatttcacgaaaatc
gttcggagtggctacgaaacctcgtcggcaagcaaagatcacacgatcaaagttgatgtg
aaagatctgcagcccgacactcaatacttctatcggttcgctgtcgagcgcgacgggaaa
ccgcactattcgcgcgtcggccggacccgaactgcgctgggtagcggcggcgagcggacg
gtcaatttcggtgtggtctcatgcagtaattacgaggccggatacttccgttcctaccgg
gatattgctgggcgggacgacctcgaatttgtcctccacctgggcgattacacctacgaa
tacgagacgggcgggtacaacggggcctacgattcgcaagttcgtgtggtgcagccggcg
gagcgcaccacgactttgcaggactatcgcatccgccagggctgctaccacgaagatcct
gacctggccgattgccacgcagccaagccgttcatttgtatttgggatgatcacgaattt
gccgacaacaattggcgtgacggggcggccggaagctcggccgaaccggatgacaattat
caggccatcaaagctgccgcgatgcaggcgtattttgaatggctaccggtgcgcgtgagt
gcggggaaccaaggttcacacctctaccgcaagctgcaatacggaaacctgatggaattc
atcattccggatttgcgcacgtaccgcgattatgaactggtttataccaataaaaagatg
ttcctcaagacggatccggattttattcgggccgccggcaaagatggccgctccatgatg
gggcaaacccagttcgaatggtttgggaatgtgctctccagctcaccgaccacgtggcag
atggttgccaatgaagtgatgttcgcacccatgactcttcccgacggtcttgaccagcgc
acacacgattggttggtcacccaaatcggactgccggaccaggggatccctctgaatacg
gatcagtgggatggttatatggccgaacggcaaaagattattgacctaatcgctgacact
aagaaaaacgtggtgttcctgacgggagatattcactcgtcgtgggccaatgatattccg
cgagatattcaaaagtatcggaccggggcatcgaaagatgttgttgccacggagtttgtg
acgccgtctattacggctaacgggcttttcgataccgtcgcgaaatcgcgggcattagac
caggcagcacggcaagtttctaccaccgctgccgacgttcttcagaagactaatgcgtgg
tttaagtggatagatttcattcaccacggatatatggcagtgagtgtctcttccgacgct
gtgtcgtgcgagtggttgcacgtcgataatgttctttccccgaacacgccgtttaggtct
gctcggaagtgtacggcatataaagataagcccggcgtacatactgatgcctag

DBGET integrated database retrieval system