KEGG   Corynebacterium kroppenstedtii: ckrop_1865Help
Entry
ckrop_1865        CDS       T00896                                 

Gene name
nanK
Definition
putative sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ckrop_1865 (nanK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ckrop_1865 (nanK)
   00052 Galactose metabolism
    ckrop_1865 (nanK)
   00500 Starch and sucrose metabolism
    ckrop_1865 (nanK)
   00520 Amino sugar and nucleotide sugar metabolism
    ckrop_1865 (nanK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ckrop_1865 (nanK)
   00524 Butirosin and neomycin biosynthesis
    ckrop_1865 (nanK)
Enzymes [BR:ckp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ckrop_1865 (nanK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2173802..2174779)
Genome map
AA seq 325 aa AA seqDB search
MALTLALDIGGTKIAWGLIDDDTPRTVIARGRIPSQPAGGTTADQLEVAVTEALASPVLA
VAGDVASTPATSSTRENKIARVGVAAAGVIDPNTATVTRAGATMPGWEGTDIAARIRRHI
DAPVFAHNDVRVWAFGEYTLCWRDEYPHSRLLYASLGTGVGGAFVTNDDLAAGNRGTAGE
ISELYCPHYGSGVARCEDVASGPGLVATYHEAISEREADPALPSTVTDLLDLERQGDSLA
TDVLDQNLHGFGQMLGTLAMGLDLDAIILGGGVSGLGELITRRIREGVRSHLAYSVRPCD
IRDSALREGPLVAAAVYARARHKLS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtggcactcacactcgcactagacattggcggtaccaagatcgcctgggggcttatcgac
gacgacacccctcgtacagtcatcgcccgcgggcgcatacccagccaacccgcgggcggg
accaccgcggaccagctggaggtcgccgtcaccgaagcgctggcgtcgccagtgctagca
gtagccggcgacgtcgcatcaaccccggcaacgtcgtcgacaagggaaaataagatcgcg
cgagttggggtggctgctgccggtgtgatcgacccgaacaccgcgacggtcacccgtgcc
ggggccactatgcctggctgggagggtaccgacattgctgcccgcatccgccgccacatc
gacgcccccgtgttcgcgcacaacgacgtccgcgtctgggcattcggcgagtacacgctg
tgttggcgcgatgagtacccgcactcccgcctgctctacgccagcttgggtacgggtgtt
ggtggagcgttcgtcacgaacgacgatctcgctgccggcaatcgtggcacggccggtgag
atttccgagctctattgccctcactacggcagcggtgtagctcggtgcgaagacgtagcg
tccggtccggggctcgttgcgacgtatcacgaagcgatctcggagcgcgaggctgaccct
gcactcccgtcgacagtgactgacctattagacctagaacgacaaggggactcattagcg
acggacgtcctggatcagaacctgcatggttttggacagatgctgggaacgctcgcgatg
ggtcttgacctcgacgcgatcatcctcggtggaggagtgtcggggctgggcgagctcatc
acgcggcggattcgcgaaggtgtgcggagccatctggcctacagtgttcgcccatgcgat
atccgcgatagtgccctgcgcgaaggcccccttgtcgccgccgctgtttacgctcgggca
cggcataaactctcgtaa

DBGET integrated database retrieval system