KEGG   Corynebacterium kroppenstedtii: ckrop_1909Help
Entry
ckrop_1909        CDS       T00896                                 

Gene name
hemB
Definition
(GenBank) Delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
ckp00860  Porphyrin and chlorophyll metabolism
ckp01100  Metabolic pathways
ckp01110  Biosynthesis of secondary metabolites
ckp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ckrop_1909 (hemB)
Enzymes [BR:ckp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ckrop_1909 (hemB)
Exosome [BR:ckp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ckrop_1909 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACR18624
UniProt: C4LLB9
Position
complement(2222042..2223091)
Genome map
AA seq 349 aa AA seqDB search
MSQTNESSQSTNRPSRDSLGLQRRPRRLRTSATMRDFVAETRLDPANLIQVLFVRHGIDQ
PEEIPSMPGQYQHTVSSLIDAVREARDAGVRCVDLFGIPLEEEKDAQGSEAWNPNGILNR
GIAAVRKEFGDSILVMADTCLDEFTDHGHCGVLTEDKHGTVVVNNDKTVPLYVKMAVSQA
KAGAHIVSPSGMMDGQVAEIRRGLDDAGYEDVSIMAYSAKYASAFFGPFRDAVGCSLQGD
RKAYQQDPANRRESLLEVQLDIDEGADMVMVKPAMAYLDVVREVADFSPVPVAAYQVSGE
YSMIEAAAQKGWIDRRRIVLESLTSIRRAGADMIFTYYATEVAHWLKDN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaactaacgaatcctctcagagcacgaaccgcccatcccgcgatagcttaggt
ctccaacgtcgcccccgccgtttgcggacgtcggcgacgatgcgggatttcgttgcagag
actcgtttagatccggccaacctgatccaggtgttatttgtccgccacggcatcgaccag
ccggaagaaatcccctccatgccggggcagtatcagcacaccgtgtcctctcttatcgac
gccgttcgcgaggcccgcgacgccggcgtgcggtgcgttgacctgttcggcatccccctc
gaggaggagaaagacgcccaagggtccgaggcctggaaccccaatggcatcctcaaccgc
gggattgccgcggtgcgtaaggaattcggtgacagcatcctggtcatggccgatacctgc
ctggacgaattcaccgatcacggccactgcggtgtgctgacggaagacaagcacgggacc
gtcgtcgttaataatgacaagaccgtgccgctctatgtgaaaatggcggtatcgcaggcc
aaggcgggggcgcacattgtcagcccgtccggaatgatggacgggcaggtcgcggaaatc
cgacgtggcctcgacgacgctggttatgaggatgtgtcgatcatggcgtactcggcgaag
tatgcgtcggcgttcttcgggccgttccgcgatgccgtgggatgctcgttgcagggcgat
cggaaggcctaccagcaggatcccgcgaaccggcgtgaatcgttgcttgaggtgcagctg
gatatcgacgaaggtgcggacatggtgatggtcaagccggccatggcgtacttggatgtg
gttcgcgaggttgcggacttttcgcccgttcccgtagctgcgtaccaggtcagcggtgag
tactccatgattgaggctgccgcgcagaaggggtggattgataggcgacgcatcgtgctg
gaatcgttgacctctatccgacgggccggcgcggacatgatcttcacgtactatgccact
gaagtagcccactggttgaaggacaactaa

DBGET integrated database retrieval system