KEGG   Corynebacterium kroppenstedtii: ckrop_1910Help
Entry
ckrop_1910        CDS       T00896                                 

Definition
uroporphyrin-III C-methyltransferase / uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ckp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2223127..2224785)
Genome map
AA seq 552 aa AA seqDB search
MTNSTPGRILFVGAGPGNPDLLTVRAREVLTSIADAWVDDGVGESICRLVGHDVPVPREK
IEEAEQEFARMVEEAKAKGSRRRPTPPPPPTAANIRSPEGDPQATADAMLAQAATGTDVI
RLVAGNPLGNTSVLAEISAVAAHDADFQVVPGMSVPSTVPSFAGIAVGSSFTETDVTGSD
DTATWDRLAQAPQPLVLQAEAQDLPVIESRLVDRGLPESTPATVTVNGTTRLQKTYDVTL
GTLTSCEGDLPGHLVVTIGVEVGARNKYSWWENRALYGWSVLVPRAKSQAGPMSTRLAQH
GAIPLEVPTISVEPPRSPAQMERAIKGLVDGRYQWIVFTSVNAVKAVWEKLTAIGLDARA
FAGVSIATVGKKTAKAVTDLGINPELMPPANARSASGLVDVFPPYDADIDPVNRVFLPRA
DIATDVLVDGLIDLGWDVDDVVAYRTVRAAPPSADIRHMIKSGGFDAVCFTSSSTVKNLV
GIAGKPHQRTIIACIGPMAAATAKECGLRVDVVPEEAGVPELVDALAEHVAGLRAAGQLP
PPRKVRKKKKSS
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaccaactcgactccagggcgcatcctgttcgtcggtgccggccccggtaaccctgac
ctcttaacggtgcgcgcacgagaagttctgacatctattgcggacgcatgggtggatgac
ggcgtcggtgaatctatttgccgcctcgtggggcacgatgtccccgtcccgcgtgagaaa
atagaggaagccgagcaagagtttgctcggatggtggaggaagcgaaagcaaaagggtct
cgccgacggccaacgccccctcctcccccgacggcggcgaatattcgcagccccgagggt
gacccgcaggcgacggccgatgccatgttggctcaggctgccacggggaccgacgttatt
cgcctggtcgcgggcaaccctttgggtaacacctcggtgttggcggaaattagtgctgtt
gctgctcatgatgccgatttccaggtcgtgccgggaatgtcggttccctcgacggttccg
tccttcgctggtatcgccgttggttcgagttttaccgaaacggatgtgacgggtagcgac
gacaccgcgacgtgggatcggctggcccaggcaccccagccgctcgttctccaggcggag
gcccaggacctccctgtcattgagtcccggctggtggaccgtggtctgcccgaaagtacg
ccggccaccgtcacggtgaatggcactactcgtttgcagaaaacctacgacgtcaccttg
ggcacgttgacatcgtgcgagggcgatctgccaggtcatttggtggtcaccattggcgtc
gaggtcggtgcgcgcaacaaatattcgtggtgggaaaaccgggctctgtacggctggtcg
gtgctggtgccccgagcgaagtcgcaggcagggccgatgagcacccgcttggctcaacac
ggtgcgatcccgttggaagtgccgacgatctctgtggagcccccgcgcagcccagcgcaa
atggaacgcgccatcaaaggcttggttgacgggcgctaccagtggatcgtcttcacctcc
gtgaacgcggtgaaagccgtgtgggagaaactgaccgcgatcggcctggacgcccgcgct
ttcgccggcgtgagcatcgcgaccgtcggaaagaaaacggccaaggctgtgacggacctg
ggcattaatcctgagctcatgcccccggccaatgcgcgttccgcgtcgggactcgtggat
gttttcccgccctatgatgccgatattgaccccgtgaacagggttttccttccccgcgcg
gatatcgccaccgacgttctggtcgacggcctcattgatttaggctgggacgtggacgat
gttgtggcctaccgcaccgttcgtgcggccccacccagcgccgatatccgccacatgatt
aagtcaggcgggttcgacgcagtgtgcttcacgtcgtcgtcgacagtgaagaaccttgtt
ggcattgccgggaaaccccaccagcgcacgattattgcctgcataggcccgatggccgca
gcgaccgcgaaagaatgtggtttgcgtgttgacgtcgtgccggaagaagccggggttccc
gaactcgtggacgcgctcgcggaacatgtggcaggtttgcgtgcggcggggcaattgccg
cctcctaggaaagtgcggaagaagaaaaagtcctcgtaa

DBGET integrated database retrieval system