KEGG   Corynebacterium kroppenstedtii: ckrop_1956Help
Entry
ckrop_1956        CDS       T00896                                 

Gene name
aceB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ckp01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ckp00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ckp00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2270365..2272566)
Genome map
AA seq 733 aa AA seqDB search
MTTATSDNTPRTKVAGLQVATTLYDFITGSVLPRTGQDPDAFWSGFADIVKTYTPRNKEL
LARREELQTKLNEWYTEHPGEQNIDDYDAFLHEIGYVVDNDDDFQIDPVNIDPEISETSG
PQLVVPVLNARFALNAANARWGSLYDALYGTDAIPEDGGAEKGNGGYNKVRGDKVIAWSR
DFLDKAVPLVDASHHDVTKYDISDGSFVGYVNDEKHELREPEVYAGYAGDKSNPTSILLR
HNGLYIDILIDPESPIGSTDKAGVKDIILDAAVSTLIDFEDSVAAVDATDKTLGYSNWFQ
LNTGELEEEVTKGDKTFTRRLNPDREYTSPDGESFTVHGRTLMFTRNVGHLMTNPAILLE
DGSEVFEGIMDTVMTAVCGIPGIDKNNPMYNSSNGSIYIVKPKQHGPEEVEFTNDLLGAT
EKLLGLPENTIKVGVMDEERRTTLNLDACIKAVSKRLAFINTGFLDRTGDEIHTSMEAGP
MIRKGEMKSAPWMQGYEDNNVDAGIAHGLPGKAQIGKGMWAKTELMADMLAEKISQPEQG
ATTAWVPSPTAATLHATHYHQVDVFTVDEKLRAAGRRDNYRDRLTVPVSPDGKWSDEDIK
EEVDNNCQSILGYVIRWVEQGVGCSKIPDIHDVDLMEDRATLRISSQLLANWLRHGIITK
DYVIEALKRMAKVVDKQNEGDPAYRPMSADYDKSIGWQAAKDLILDGTTSPSGYTEPILH
QRRREFKEREGIA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgccacgtccgacaacacaccccgcaccaaagtcgctggccttcaggtggcc
accaccctttatgacttcattaccggctcggtccttccccgcaccggccaggaccccgac
gctttctggtccggcttcgcggacatcgtgaaaacctatacgcctcgcaataaggaactc
ttagcgcgccgcgaggaactgcaaaccaagctcaatgagtggtacaccgagcaccccggc
gagcaaaacatcgacgattacgacgccttcctccacgagatcggctacgtggtggacaat
gacgatgacttccagatcgaccccgtcaatatcgaccccgagatctcggaaaccagtggc
cctcaactggtggttcccgtgctcaacgcccgcttcgcgctgaacgctgcgaacgcccgg
tggggttcgttatatgacgccctctacggcaccgacgccatccccgaggacggtggcgcc
gaaaagggtaacggcggctacaacaaagtccgcggcgataaggtcatcgcctggtcgcgt
gatttcctcgacaaggcagttcccctggtcgacgcatcccaccacgacgtcaccaagtac
gacatttccgacggatccttcgtcggctatgtcaacgatgagaagcatgagctgcgcgaa
ccggaggtttacgccggatacgccggggacaagtccaacccgacgtcgattttgttgcgg
cacaacgggctgtacatcgacattttgatcgaccccgaatcccccatcggatccaccgac
aaggccggagtcaaggacattattctcgacgccgccgtcagtacgttgatcgactttgaa
gactccgtggccgccgtcgatgcgaccgataaaaccctggggtacagcaactggttccag
ctgaacaccggtgagctggaagaagaggtgacgaagggggacaagacgttcacccgtcgg
ctcaaccccgaccgcgaatacaccagtccggacggcgaatccttcaccgttcacggccgc
accttgatgtttacccgcaatgtgggccacctcatgaccaacccggcgatcctgctggaa
gacgggtccgaggtgttcgaaggcatcatggacaccgtcatgaccgccgtgtgcggcatc
ccggggattgacaagaacaaccccatgtacaactccagcaatgggtcgatctacatcgtg
aagcccaagcagcacgggccggaggaagtggaattcaccaacgacctgctgggtgccacc
gagaagctcctgggtctcccggagaacaccatcaaggtcggagtgatggatgaagagcga
cggaccacgctgaacctcgacgcatgtatcaaggccgtgtccaagcggctggccttcatt
aacaccggctttctggaccgcaccggcgacgaaatccacacctccatggaggccggcccc
atgatccgcaagggcgaaatgaaatccgctccctggatgcagggttatgaggacaacaat
gtcgacgctggcatcgcccacggactacccggcaaggcgcagatcggtaagggaatgtgg
gcaaagaccgagctcatggctgacatgttggccgagaagatcagccagccggaacagggg
gccaccaccgcgtgggttccgtcgcccaccgcagcaacactgcacgccacgcactatcac
caggtggacgtgttcactgtcgacgagaaactccgcgctgctgggcgtcgtgataactac
cgcgaccgcctcaccgtccccgtatcgccggacggaaagtggagcgatgaagacattaag
gaagaggtagacaacaactgccagtccatcctgggctacgtcatccgctgggtggagcag
ggcgttggttgctccaagattccggatattcacgacgttgacctcatggaagaccgcgct
acgctgcgtatttcctcgcagctgctggccaattggctgcgtcacggcatcattacgaag
gattacgtgatcgaggcattgaagcgcatggcgaaagtcgtcgataagcaaaatgaggga
gacccggcgtaccgcccgatgtcggctgattatgacaagtcgatcggttggcaggcggcg
aaggacctgattttggacgggacgacctcgccctccggctacaccgagccgattctgcac
cagcgccgtcgcgaattcaaggaacgcgaagggatcgcatag

DBGET integrated database retrieval system