KEGG   Corynebacterium kroppenstedtii: ckrop_1956Help
Entry
ckrop_1956        CDS       T00896                                 

Gene name
aceB
Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
ckp00620  Pyruvate metabolism
ckp00630  Glyoxylate and dicarboxylate metabolism
ckp01100  Metabolic pathways
ckp01110  Biosynthesis of secondary metabolites
ckp01120  Microbial metabolism in diverse environments
ckp01200  Carbon metabolism
Module
ckp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ckrop_1956 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    ckrop_1956 (aceB)
Enzymes [BR:ckp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ckrop_1956 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: ACR18666
UniProt: C4LLG1
Position
complement(2270365..2272566)
Genome map
AA seq 733 aa AA seqDB search
MTTATSDNTPRTKVAGLQVATTLYDFITGSVLPRTGQDPDAFWSGFADIVKTYTPRNKEL
LARREELQTKLNEWYTEHPGEQNIDDYDAFLHEIGYVVDNDDDFQIDPVNIDPEISETSG
PQLVVPVLNARFALNAANARWGSLYDALYGTDAIPEDGGAEKGNGGYNKVRGDKVIAWSR
DFLDKAVPLVDASHHDVTKYDISDGSFVGYVNDEKHELREPEVYAGYAGDKSNPTSILLR
HNGLYIDILIDPESPIGSTDKAGVKDIILDAAVSTLIDFEDSVAAVDATDKTLGYSNWFQ
LNTGELEEEVTKGDKTFTRRLNPDREYTSPDGESFTVHGRTLMFTRNVGHLMTNPAILLE
DGSEVFEGIMDTVMTAVCGIPGIDKNNPMYNSSNGSIYIVKPKQHGPEEVEFTNDLLGAT
EKLLGLPENTIKVGVMDEERRTTLNLDACIKAVSKRLAFINTGFLDRTGDEIHTSMEAGP
MIRKGEMKSAPWMQGYEDNNVDAGIAHGLPGKAQIGKGMWAKTELMADMLAEKISQPEQG
ATTAWVPSPTAATLHATHYHQVDVFTVDEKLRAAGRRDNYRDRLTVPVSPDGKWSDEDIK
EEVDNNCQSILGYVIRWVEQGVGCSKIPDIHDVDLMEDRATLRISSQLLANWLRHGIITK
DYVIEALKRMAKVVDKQNEGDPAYRPMSADYDKSIGWQAAKDLILDGTTSPSGYTEPILH
QRRREFKEREGIA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgccacgtccgacaacacaccccgcaccaaagtcgctggccttcaggtggcc
accaccctttatgacttcattaccggctcggtccttccccgcaccggccaggaccccgac
gctttctggtccggcttcgcggacatcgtgaaaacctatacgcctcgcaataaggaactc
ttagcgcgccgcgaggaactgcaaaccaagctcaatgagtggtacaccgagcaccccggc
gagcaaaacatcgacgattacgacgccttcctccacgagatcggctacgtggtggacaat
gacgatgacttccagatcgaccccgtcaatatcgaccccgagatctcggaaaccagtggc
cctcaactggtggttcccgtgctcaacgcccgcttcgcgctgaacgctgcgaacgcccgg
tggggttcgttatatgacgccctctacggcaccgacgccatccccgaggacggtggcgcc
gaaaagggtaacggcggctacaacaaagtccgcggcgataaggtcatcgcctggtcgcgt
gatttcctcgacaaggcagttcccctggtcgacgcatcccaccacgacgtcaccaagtac
gacatttccgacggatccttcgtcggctatgtcaacgatgagaagcatgagctgcgcgaa
ccggaggtttacgccggatacgccggggacaagtccaacccgacgtcgattttgttgcgg
cacaacgggctgtacatcgacattttgatcgaccccgaatcccccatcggatccaccgac
aaggccggagtcaaggacattattctcgacgccgccgtcagtacgttgatcgactttgaa
gactccgtggccgccgtcgatgcgaccgataaaaccctggggtacagcaactggttccag
ctgaacaccggtgagctggaagaagaggtgacgaagggggacaagacgttcacccgtcgg
ctcaaccccgaccgcgaatacaccagtccggacggcgaatccttcaccgttcacggccgc
accttgatgtttacccgcaatgtgggccacctcatgaccaacccggcgatcctgctggaa
gacgggtccgaggtgttcgaaggcatcatggacaccgtcatgaccgccgtgtgcggcatc
ccggggattgacaagaacaaccccatgtacaactccagcaatgggtcgatctacatcgtg
aagcccaagcagcacgggccggaggaagtggaattcaccaacgacctgctgggtgccacc
gagaagctcctgggtctcccggagaacaccatcaaggtcggagtgatggatgaagagcga
cggaccacgctgaacctcgacgcatgtatcaaggccgtgtccaagcggctggccttcatt
aacaccggctttctggaccgcaccggcgacgaaatccacacctccatggaggccggcccc
atgatccgcaagggcgaaatgaaatccgctccctggatgcagggttatgaggacaacaat
gtcgacgctggcatcgcccacggactacccggcaaggcgcagatcggtaagggaatgtgg
gcaaagaccgagctcatggctgacatgttggccgagaagatcagccagccggaacagggg
gccaccaccgcgtgggttccgtcgcccaccgcagcaacactgcacgccacgcactatcac
caggtggacgtgttcactgtcgacgagaaactccgcgctgctgggcgtcgtgataactac
cgcgaccgcctcaccgtccccgtatcgccggacggaaagtggagcgatgaagacattaag
gaagaggtagacaacaactgccagtccatcctgggctacgtcatccgctgggtggagcag
ggcgttggttgctccaagattccggatattcacgacgttgacctcatggaagaccgcgct
acgctgcgtatttcctcgcagctgctggccaattggctgcgtcacggcatcattacgaag
gattacgtgatcgaggcattgaagcgcatggcgaaagtcgtcgataagcaaaatgaggga
gacccggcgtaccgcccgatgtcggctgattatgacaagtcgatcggttggcaggcggcg
aaggacctgattttggacgggacgacctcgccctccggctacaccgagccgattctgcac
cagcgccgtcgcgaattcaaggaacgcgaagggatcgcatag

DBGET integrated database retrieval system