KEGG   Corynebacterium kroppenstedtii: ckrop_3001Help
Entry
ckrop_3001        CDS       T00896                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
ckp00240  Pyrimidine metabolism
ckp00250  Alanine, aspartate and glutamate metabolism
ckp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ckp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ckrop_3001 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ckrop_3001 (pyrB)
Enzymes [BR:ckp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     ckrop_3001 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACR17746
UniProt: C4LIU1
Position
complement(1182270..1183226)
Genome map
AA seq 318 aa AA seqDB search
MKHLLSMADLSADEITGLLDEAQNFKEALEGRELKKLPTLRGRTIFTVFYENSTRTRSSF
ETAGKWMSADVINISASSSSVKKGESLQDTGLTLTAIGADALIIRHPSSGAAQQLAHWVA
PNGDGPSVINAGDGAHQHPTQALLDALTLRQRLGGINGRKIVIVGDILHSRVARSNAELL
TKLGAEVVYVAPPTLLPYGVETWPVRISYDMDSELADADAIMMLRVQAERMAGGFFPSHR
EYATLYGMSTAREAKMKDKAIIMHPGPMLRGMEINYSVADAPRTAVLQQVNNGVHVRMAV
LFSLIIGTHGQSHTTKES
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccttctctcgatggcggatctctctgccgatgaaatcactggcctcttagac
gaagcgcagaactttaaggaagccctcgaaggacgcgaactcaagaagctgcccaccctc
cgaggccgcacaatcttcaccgtgttctacgaaaactccacccgcacacgatccagcttt
gaaacagcaggaaagtggatgagcgccgacgtcatcaacatcagtgcatcgtcctcaagc
gtgaaaaagggggagtccctccaagacaccggtttaactctcacagcgattggcgccgac
gctctcatcattcgccatcccagctccggagcggcgcaacaattagcccactgggtggct
cccaacggggacggacccagcgtcatcaacgctggtgatggtgcccatcaacacccgaca
caggcactgttggacgcgcttactcttcggcaacgcctcggcggaatcaacgggcgaaaa
atcgtgatcgtgggggatatcctccactcgcgcgtcgcgcgctctaatgccgagttattg
acaaaactgggggcggaagtcgtctatgtcgccccgccgacgctgctcccgtatggggta
gagacgtggccggtccggatttcctatgacatggattccgagcttgccgacgccgatgcc
atcatgatgctgcgcgttcaagccgaacgcatggccggagggttcttccccagccaccgc
gaatacgccacgttatacggaatgagcactgcgcgtgaggccaagatgaaagataaggcc
atcatcatgcacccggggcccatgcttcgtggcatggagattaattattccgtagcggat
gccccccgaactgcggttttgcaacaggttaacaacggtgtccacgtccgcatggcggtt
ctgttctcgctcatcatcggtacccacggacaatctcacacaacgaaggagtcataa

DBGET integrated database retrieval system