KEGG   Clostridium kluyveri NBRC 12016: CKR_0446Help
Entry
CKR_0446          CDS       T00832                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ckr00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
481308..482297
Genome map
AA seq 329 aa AA seqDB search
MIKIPERMNMANLPTKIEKMERLSQKLGGPDIYIKRDDQTGTEISGNKIRKLEFSAAEAL
NKGCNTLITCGGIQSNHCRATAAVAVKLGFKCCLVLNGSNDTEVDGNLLLDKLLGAEIYF
VSQKEYENRRMEIMKEIKTNMENKGLKPYIIPEGASNGIGGFGYYKAVQEIMLQEREMKV
HFDGIVIATGSGGTYSGLLLGSRILNYDAKIYGVNVCQNEKYFKDRIYEILHDSMKYIDV
NLNFSKDEINIIDGYVGRGYALSREEELEFIKELAELEGIILDPVYTGKAMYGLTQEIKK
GKFSKYKNLLFIHTGGIFGIFPQKSQFRV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaattccagaaagaatgaacatggctaatttgccaactaaaatagagaaaatg
gagagactatcccaaaaactaggtggaccagatatatatataaagcgggatgatcagaca
ggaacagagatctctggaaataagataagaaagttagaattttctgcagcagaagctttg
aataaaggatgtaatacattaattacttgtggtggaattcagtcgaatcattgtagggct
actgcagcagtggctgtaaagctcggttttaagtgttgtctggttctaaatggcagtaat
gatacagaagtcgatggaaaccttttactggataagcttttaggagctgaaatttatttt
gtttctcaaaaagaatatgaaaatagaagaatggaaattatgaaagaaattaaaaccaat
atggaaaataaggggctgaaaccttatattattccagagggtgcatcaaatggaatagga
ggttttggttattataaagctgtacaggaaataatgctccaagaaagagaaatgaaagta
cattttgatggaattgttattgctacaggttccgggggaacctattcaggactgttatta
ggcagcagaatattaaattatgatgctaaaatttatggagttaatgtatgtcagaatgag
aaatattttaaggacaggatttatgaaatattgcatgatagcatgaaatatattgatgtg
aaccttaatttttcaaaggatgaaataaatatcatagatggatatgtaggcagaggatat
gctttgagccgtgaagaggaactggaatttattaaggaacttgcagagttagaagggata
atattggatcctgtatatacaggtaaagcaatgtatggattgacccaggaaattaaaaaa
gggaaattcagtaaatataaaaatttattatttatccatactggaggaatatttggaata
tttcctcaaaaatctcagtttagagtttaa

DBGET integrated database retrieval system