KEGG   Clostridium kluyveri NBRC 12016: CKR_0499Help
Entry
CKR_0499          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ckr  Clostridium kluyveri NBRC 12016
Brite
Enzymes [BR:ckr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     CKR_0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
542406..543416
Genome map
AA seq 336 aa AA seqDB search
MNNRIYLLTGAAGLLGSNVSRQLIDRGEQVRALVLNGDPAVKYIPEEVELVSGDVTDTES
LQKFFTVSESTDIYVIHCASIVTLNPNPNGKVHAVNVGGTQNIIDKCVEHQVKKLVYISS
TGAIPELPGNMPIKEVTHFGIEGLVGYYSVTKAEASQLVIDALAKYPQLDASLVHPSGIC
GPNDYSFGPVADFIMQYVNGNMPAGVAGTFNSVDVRDLSEGVIACCDKGRRGQCYIMSND
LVSMQDMFKLINHAAGLNYNPKILSVPVAKVVAKVMGVVGKITGKPARLTGFAIYNLTRN
NNFNCSKAVHELRFKCRPFEETISDEVRWLKMEGKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagaatttatttattaaccggagcagcaggacttttaggaagcaatgtatca
agacaactgattgatcgtggagaacaggtgagggcacttgtgttaaatggagatccggca
gttaaatatataccggaagaagtagaacttgtaagtggagatgtgacggacacagaatct
ttacaaaaattttttacagtatctgaaagcacagatatctatgttatccattgtgcaagt
atcgttacattgaatccaaaccctaatgggaaggttcatgccgtaaatgtaggtggaact
cagaatatcattgataaatgtgtagagcatcaggttaaaaaattggtgtatattagctct
actggagctattccagagcttcctggtaatatgccaattaaggaagtaactcattttgga
atagaaggattggttggttattattctgttactaaagcagaagcttcacaattagtaata
gatgcattggcaaagtatccgcagctggatgcatcccttgttcatccaagtggaatttgt
ggccccaatgattattcttttggaccagttgcagattttataatgcagtacgtaaatggt
aatatgccagcaggtgttgcaggaacatttaatagtgttgatgttcgcgatttgtcagag
ggagtaattgcctgctgtgacaaaggaagacgtggacaatgttatattatgagtaatgat
cttgtatcaatgcaggatatgtttaagttgataaatcatgcagcaggattaaattacaat
ccaaagattctgtcagtacctgtagcaaaagttgtggcaaaagtaatgggagttgtgggt
aaaatcacaggaaagccagcacggttgacaggttttgcaatttataacctgacacgtaat
aataattttaactgtagtaaagcagtccatgaacttagatttaaatgccgtccatttgaa
gaaacaatcagtgatgaggttcgttggctgaaaatggaaggaaaaatttag

DBGET integrated database retrieval system