KEGG   Clostridium kluyveri NBRC 12016: CKR_0509Help
Entry
CKR_0509          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CKR_0509
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CKR_0509
Enzymes [BR:ckr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CKR_0509
Two-component system [BR:ckr02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CKR_0509
Bacterial motility proteins [BR:ckr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CKR_0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(551922..552965)
Genome map
AA seq 347 aa AA seqDB search
MRTGKKIKVLVVDDSLVFREVLSRGISSDPYIEVIAKAVDPFDARDKIPKFHPSVMICNV
EMPKMNGIEFIRRLIPQYPLPTVVVSTISESVFEAMRAGAVDFVTKPDVQSVKNVEIFIK
ELILKIKIASIAKVPNRELNNISRGIISHKSSKVVNKIKIIAIGASTGGTEAIYNVLKYL
PRNTPGIVIVQHIPPIFSRMFTERLNTNSISLKVKEAQTGDIVEMGNVLIVPGNKHMRLK
KIDGKYKVECFSGERVNGHCPSVDLLFESVAKEIGSNAVGVILTGMGYDGAKGLLSMRKA
GARTIGQNEKSSIVYGMPKVAYDIGAVEKQVSLENIPNLIYSLIKEG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgcggacgggaaaaaagataaaagtattagtagttgatgatagtctcgtattcagagaa
gtattatcaagggggatttcctctgatccatacatagaagtaatagcaaaagctgttgat
ccctttgacgcaagggataagataccgaaatttcatcctagcgttatgatatgtaatgtg
gaaatgcctaagatgaacggtatagaatttatacggaggcttataccacaatatcctctg
cctacggttgttgtcagtacaataagtgaatcggtattcgaagctatgagggcaggagca
gttgattttgttacaaaacctgatgtccagtctgttaaaaatgtagagatatttataaag
gagcttatacttaaaattaaaatagcttcaatagctaaagtacctaatagagaattaaat
aatatatcaagagggatcataagtcataaaagtagtaaagtagttaataaaataaaaata
attgcaattggagcttccacaggaggaacagaggctatatacaatgtattgaaatatctt
cctagaaatactccaggcattgttatagtccagcatattcctcctatattttcacgtatg
tttacagaaaggttaaatactaattcaatttccctaaaagtaaaggaagcccagactgga
gacatagtggaaatgggaaatgtactaatagtacctggaaataaacatatgaggcttaaa
aaaatagacggcaaatataaagttgaatgcttttctggagaacgggtaaatggtcactgt
ccctcagtagatttactatttgaatctgtagcaaaagaaattggtagtaatgctgtagga
gtaatactaacaggcatgggatatgacggagctaaaggtcttctatctatgaggaaagcc
ggtgcaagaaccattggtcagaatgaaaaatcaagtatagtctatgggatgccgaaagta
gcatatgatattggagcagtagaaaaacaagtatctcttgaaaatatacctaatttaata
tattcattaataaaggaaggataa

DBGET integrated database retrieval system