KEGG   Clostridium kluyveri NBRC 12016: CKR_0635Help
Entry
CKR_0635          CDS       T00832                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CKR_0635
Enzymes [BR:ckr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CKR_0635
Exosome [BR:ckr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CKR_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
706947..707948
Genome map
AA seq 333 aa AA seqDB search
MKGYINSGGKKMFKRYRRLRKNYAIRSMVRETVLNEEDFVYPLFIVEGNNIKKEIKSLPG
NFHWSVDRLDELVEDIVRAGVKGVIIFGIPNYKDDVGSGAYDDEGIVQKAVREIKRIAPD
IWVITDVCMCEYTSHGHCGIVIDNSVDNDETLKYIAKIALSHAQSGADMVAPSDMMDGRV
GAIRSILDENGYKDVSIMAYSAKYASAFYGPFREAADCCPEFGDRKSYQMDPANSREAML
EIQEDIDEGADIVMIKPALPYLDIIKMTRDKFDNPIAAYSVSGEFAMIKAAAALGVIDEK
AIVLESLTSIKRAGADIIITYHAIDVARWIRRD
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggatatatcaattctggaggtaaaaagatgtttaaaagatatagaagacttagg
aaaaattatgcaataaggagtatggtaagggaaacagtattaaatgaagaagattttgtt
tatcctttgtttattgtagaaggaaataatataaagaaagaaataaaatctcttcctgga
aattttcattggtctgtggataggcttgacgaattggtggaggatatagtcagagcagga
gtaaaaggtgtaatcatttttggaattccaaattataaagatgatgtaggcagcggagcc
tatgatgatgaaggtatagttcaaaaagcagtgcgtgaaataaagagaattgcaccggat
atttgggttattacagatgtttgtatgtgtgaatatactagccatggacactgcggcata
gtaatagataattctgtagataatgatgaaacattaaagtatatagctaaaatagctctt
tcccatgcacagtcaggagctgatatggtggcaccttctgatatgatggatggaagagta
ggggcaatcagaagtattttagatgaaaatggctacaaagatgtaagtattatggcctat
agtgccaagtatgcatctgctttttatggaccttttagggaagctgcagattgctgccct
gaatttggagatagaaagagctatcagatggatcctgcaaatagcagagaagctatgctg
gaaattcaggaggatattgatgagggagcggatatagttatgataaagcctgccctacct
tacctggatataataaaaatgacaagagataaatttgataatcctatagcggcatatagt
gtaagtggagaatttgccatgattaaagctgcagcagcccttggagttatagatgaaaaa
gccatagtacttgagagccttacatccattaaaagagcgggagcagatataataataact
tatcatgcaatagacgtagcaaggtggattagaagagattga

DBGET integrated database retrieval system