KEGG   Clostridium kluyveri NBRC 12016: CKR_0641Help
Entry
CKR_0641          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CKR_0641
Enzymes [BR:ckr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CKR_0641
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CKR_0641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
712543..714015
Genome map
AA seq 490 aa AA seqDB search
MGKVYLIGAGPGNEELVTLKAVRVLKECTVVLYDRLSGESLLRYLNEDCKIFYCGKEPGC
HYRSQEEINNMLVKFAKEGHIVGRIKGGDPYVFGRGGEEGIRLSKENIPFETVPGITSAI
AVLNYGGIPITHRDISRSFHVFTAMTREGTSLQWEYISKLSGTLVFLMGMEHIGEIFRKL
MENGKNKNTPAAVIMRGTTSRQKMVTGNLMNIVEKAKSENLKAPCIIVVGEVVSLSKYLN
WYNNMELYGTNVCITRSREQSYEVKNKLIELGAEVTEINAIKILNTSENMDGYLNKLHRY
DFIVMTSVNSVNIFFNYLKEKRYDIRNVKGKFAVIGSATERTLMENGIYADMRAKEFSSK
NLEEALMKKVKKSDSILIPCSKLSRGKIAQSLIDFGCQVDEVHIYEPVQGEMSGEKAFDE
VDVVFFTSPSTVRNMINMVGLDKLRRKINIAIGPITFKELEKHSISSLISDEFTTKGMIK
KLLQFKQNKD
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtatatttgataggggcaggacctggaaatgaagaattagttactttaaag
gcagtaagagttttaaaggaatgtacggtagtgctatacgacaggctttcaggggaaagt
ttacttagatatttaaatgaggattgcaaaatattttattgtggaaaagaaccaggatgc
cactatagatctcaagaagaaataaataatatgcttgttaagtttgcaaaagagggtcat
atagtcggaagaataaaaggaggagatccttatgtatttggaagagggggagaagaaggc
ataagattaagcaaagagaatattcccttcgaaactgttccaggaattacatctgccata
gctgttttaaattatggtggaattcctattacccatagggacatttcaagaagttttcac
gtgtttacagctatgaccagggaaggaacaagtctccaatgggaatatatttccaagttg
tcgggaaccttggtttttcttatgggaatggagcatataggagaaatatttagaaaactt
atggaaaatgggaaaaataaaaatacccctgcggcagtaataatgagaggaacaacctca
agacaaaagatggtgacgggtaatttgatgaatatagtggaaaaggcgaaaagtgagaac
cttaaagcaccttgtattatagtagttggggaagtggtctctcttagtaaatatttaaac
tggtataataatatggaattatacggcactaatgtgtgcattacaaggagcagggaacaa
tcttatgaagttaaaaataaactgattgaattaggggcagaggtaacggaaatcaatgca
ataaaaattttaaatacctcagaaaatatggatggttatttaaataaacttcacaggtat
gactttatagttatgaccagtgtaaatagtgtaaatatattttttaattatctaaaagaa
aaaagatatgatataagaaatgtaaaagggaaatttgcagtaattggctctgctacggaa
aggactttaatggaaaatggtatatatgcggatatgagggctaaagaattttcaagtaaa
aatttagaggaagcccttatgaaaaaggttaaaaaatctgacagcatattaataccctgt
tccaaactatcacgaggaaaaatagcacaaagtttaattgattttgggtgtcaggtagat
gaagtacatatttatgaaccggtacagggagaaatgtctggtgagaaagcttttgacgaa
gtagatgtggtgttttttacaagcccttctacggtaaggaatatgataaatatggtggga
ttagataagcttcgtagaaaaatcaatatagctatagggcctattacctttaaagaactg
gaaaagcacagtatatccagccttataagtgatgaatttacaacaaaaggtatgattaaa
aaacttttacaatttaagcaaaataaggattag

DBGET integrated database retrieval system