KEGG   Clostridium kluyveri NBRC 12016: CKR_0654Help
Entry
CKR_0654          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Module
Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CKR_0654
Enzymes [BR:ckr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     CKR_0654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
724258..724839
Genome map
AA seq 193 aa AA seqDB search
MLELILIRHGQTDSNRKGTYSGWTDIELNKCGISQAERVRDKLKHINFDLVVASPLKRAK
KTAEIISKNIIYDEGLKEINFGLWDNLSLEEIEEKYPEEYELWMRDKKEEFIFPQGESIK
DVQERAANVIDNIIKKQKKGIVLIVTHGGLIRNIVAHLLGMGRAGSWRFRIDNCGITKIQ
ITDGYAVLTELNG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgttagaattgattttgataagacacggacaaactgacagcaatagaaagggaacatat
tcaggctggacagatatagaacttaataaatgtggaattagtcaggctgagagggtaaga
gataaactaaaacacataaattttgatcttgtagtggctagtccacttaaaagggctaaa
aaaactgctgagattatcagcaaaaatataatttacgatgaaggacttaaggaaattaat
tttgggttatgggacaacctgtctttagaggaaattgaagaaaagtatccagaggagtat
gagttatggatgagagataaaaaagaggaatttatttttccacagggagaaagtataaag
gatgtgcaggaaagggcggcaaatgttattgataatataatcaaaaaacagaaaaagggt
attgttttaattgttacccatggaggcttaataagaaatattgtagcacacttgcttggt
atgggcagggcaggatcctggcgttttcgtatagataattgtggtataactaaaattcag
ataacagatggatatgccgtcttaactgaactaaatggataa

DBGET integrated database retrieval system